KEGG   Homo sapiens (human): 3105
Entry
3105              CDS       T01001                                 
Symbol
HLA-A, HLAA
Name
(RefSeq) major histocompatibility complex, class I, A
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3105 (HLA-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3105 (HLA-A)
   04145 Phagosome
    3105 (HLA-A)
  09143 Cell growth and death
   04218 Cellular senescence
    3105 (HLA-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3105 (HLA-A)
   04612 Antigen processing and presentation
    3105 (HLA-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3105 (HLA-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3105 (HLA-A)
   05170 Human immunodeficiency virus 1 infection
    3105 (HLA-A)
   05168 Herpes simplex virus 1 infection
    3105 (HLA-A)
   05163 Human cytomegalovirus infection
    3105 (HLA-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3105 (HLA-A)
   05169 Epstein-Barr virus infection
    3105 (HLA-A)
   05165 Human papillomavirus infection
    3105 (HLA-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3105 (HLA-A)
   05330 Allograft rejection
    3105 (HLA-A)
   05332 Graft-versus-host disease
    3105 (HLA-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3105 (HLA-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3105 (HLA-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3105 (HLA-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3105 (HLA-A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3105 (HLA-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3105 (HLA-A)
SSDB
Motif
Pfam: MHC_I MHC_I_C C1-set Ig_3 C2-set_2 ig MHC_I_3
Other DBs
NCBI-GeneID: 3105
NCBI-ProteinID: NP_001229687
OMIM: 142800
HGNC: 4931
Ensembl: ENSG00000206503
Pharos: P30443(Tbio)
UniProt: P04439 Q5SUL5
Structure
LinkDB
Position
6:29942532..29945870
AA seq 365 aa
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggccgtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactccatgaggtatttcttcacatccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaagatggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccaggagacacggaatatgaaggcccactcacagactgaccgagcg
aacctggggaccctgcgcggctactacaaccagagcgaggacggttctcacaccatccag
ataatgtatggctgcgacgtggggccggacgggcgcttcctccgcgggtaccggcaggac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg
gacatggcagctcagatcaccaagcgcaagtgggaggcggtccatgcggcggagcagcgg
agagtctacctggagggccggtgcgtggacgggctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagctg
tcttcccagcccaccatccccatcgtgggcatcattgctggcctggttctccttggagct
gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa
ggagggagttacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Homo sapiens (human): 3106
Entry
3106              CDS       T01001                                 
Symbol
HLA-B, AS, B-4901, HLAB
Name
(RefSeq) major histocompatibility complex, class I, B
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01476  Behcet disease
H01507  Seronegative arthritis
H01674  Ankylosing spondylitis
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3106 (HLA-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3106 (HLA-B)
   04145 Phagosome
    3106 (HLA-B)
  09143 Cell growth and death
   04218 Cellular senescence
    3106 (HLA-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3106 (HLA-B)
   04612 Antigen processing and presentation
    3106 (HLA-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3106 (HLA-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3106 (HLA-B)
   05170 Human immunodeficiency virus 1 infection
    3106 (HLA-B)
   05168 Herpes simplex virus 1 infection
    3106 (HLA-B)
   05163 Human cytomegalovirus infection
    3106 (HLA-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3106 (HLA-B)
   05169 Epstein-Barr virus infection
    3106 (HLA-B)
   05165 Human papillomavirus infection
    3106 (HLA-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3106 (HLA-B)
   05330 Allograft rejection
    3106 (HLA-B)
   05332 Graft-versus-host disease
    3106 (HLA-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3106 (HLA-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3106 (HLA-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3106 (HLA-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3106 (HLA-B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3106 (HLA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3106 (HLA-B)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Other DBs
NCBI-GeneID: 3106
NCBI-ProteinID: NP_005505
OMIM: 142830
HGNC: 4932
Ensembl: ENSG00000234745
Pharos: P01889(Tbio)
UniProt: P01889 E5FQ95
Structure
LinkDB
Position
6:complement(31353875..31357179)
AA seq 362 aa
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

KEGG   Homo sapiens (human): 3107
Entry
3107              CDS       T01001                                 
Symbol
HLA-C, D6S204, HLA-JY3, HLAC, HLC-C, MHC, PSORS1
Name
(RefSeq) major histocompatibility complex, class I, C
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01563  HIV infection
H01656  Psoriasis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3107 (HLA-C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3107 (HLA-C)
   04145 Phagosome
    3107 (HLA-C)
  09143 Cell growth and death
   04218 Cellular senescence
    3107 (HLA-C)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3107 (HLA-C)
   04612 Antigen processing and presentation
    3107 (HLA-C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3107 (HLA-C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3107 (HLA-C)
   05170 Human immunodeficiency virus 1 infection
    3107 (HLA-C)
   05168 Herpes simplex virus 1 infection
    3107 (HLA-C)
   05163 Human cytomegalovirus infection
    3107 (HLA-C)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3107 (HLA-C)
   05169 Epstein-Barr virus infection
    3107 (HLA-C)
   05165 Human papillomavirus infection
    3107 (HLA-C)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3107 (HLA-C)
   05330 Allograft rejection
    3107 (HLA-C)
   05332 Graft-versus-host disease
    3107 (HLA-C)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3107 (HLA-C)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3107 (HLA-C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3107 (HLA-C)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3107 (HLA-C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3107 (HLA-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3107 (HLA-C)
SSDB
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 MHC_I_3 ig FeoB_associated
Other DBs
NCBI-GeneID: 3107
NCBI-ProteinID: NP_002108
OMIM: 142840
HGNC: 4933
Ensembl: ENSG00000204525
Pharos: P10321(Tbio)
UniProt: P10321 Q6R739 Q95HC2
Structure
LinkDB
Position
6:complement(31268749..31272092)
AA seq 366 aa
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgagccctcctcctgctgctctcgggaggcctggccctgacc
gagacctgggcctgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatctcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
agcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccctccag
aggatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagttggaggcggcccgtgcggcggagcagctg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagctgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcaccgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

KEGG   Homo sapiens (human): 3108
Entry
3108              CDS       T01001                                 
Symbol
HLA-DMA, D6S222E, DMA, HLADM, RING6
Name
(RefSeq) major histocompatibility complex, class II, DM alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00083  Allograft rejection
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3108 (HLA-DMA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3108 (HLA-DMA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3108 (HLA-DMA)
   04612 Antigen processing and presentation
    3108 (HLA-DMA)
   04658 Th1 and Th2 cell differentiation
    3108 (HLA-DMA)
   04659 Th17 cell differentiation
    3108 (HLA-DMA)
   04672 Intestinal immune network for IgA production
    3108 (HLA-DMA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3108 (HLA-DMA)
   05164 Influenza A
    3108 (HLA-DMA)
   05168 Herpes simplex virus 1 infection
    3108 (HLA-DMA)
   05169 Epstein-Barr virus infection
    3108 (HLA-DMA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3108 (HLA-DMA)
   05152 Tuberculosis
    3108 (HLA-DMA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3108 (HLA-DMA)
   05140 Leishmaniasis
    3108 (HLA-DMA)
  09163 Immune disease
   05310 Asthma
    3108 (HLA-DMA)
   05322 Systemic lupus erythematosus
    3108 (HLA-DMA)
   05323 Rheumatoid arthritis
    3108 (HLA-DMA)
   05320 Autoimmune thyroid disease
    3108 (HLA-DMA)
   05321 Inflammatory bowel disease
    3108 (HLA-DMA)
   05330 Allograft rejection
    3108 (HLA-DMA)
   05332 Graft-versus-host disease
    3108 (HLA-DMA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3108 (HLA-DMA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3108 (HLA-DMA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3108 (HLA-DMA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3108 (HLA-DMA)
  Exosomal proteins of epithelial cells
   3108 (HLA-DMA)
  Exosomal proteins of breast milk
   3108 (HLA-DMA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set FAST_1
Other DBs
NCBI-GeneID: 3108
NCBI-ProteinID: NP_006111
OMIM: 142855
HGNC: 4934
Ensembl: ENSG00000204257
UniProt: Q31604 Q6ICR9
Structure
LinkDB
Position
6:complement(32948618..32953097)
AA seq 261 aa
MGHEQNQGAALLQMLPLLWLLPHSWAVPEAPTPMWPDDLQNHTFLHTVYCQDGSPSVGLS
EAYDEDQLFFFDFSQNTRVPRLPEFADWAQEQGDAPAILFDKEFCEWMIQQIGPKLDGKI
PVSRGFPIAEVFTLKPLEFGKPNTLVCFVSNLFPPMLTVNWQHHSVPVEGFGPTFVSAVD
GLSFQAFSYLNFTPEPSDIFSCIVTHEIDRYTAIAYWVPRNALPSDLLENVLCGVAFGLG
VLGIIVGIVLIIYFRKPCSGD
NT seq 786 nt   +upstreamnt  +downstreamnt
atgggtcatgaacagaaccaaggagctgcgctgctacagatgttaccacttctgtggctg
ctaccccactcctgggccgtccctgaagctcctactccaatgtggccagatgacctgcaa
aaccacacattcctgcacacagtgtactgccaggatgggagtcccagtgtgggactctct
gaggcctacgacgaggaccagcttttcttcttcgacttttcccagaacactcgggtgcct
cgcctgcccgaatttgctgactgggctcaggaacagggagatgctcctgccattttattt
gacaaagagttctgcgagtggatgatccagcaaatagggccaaaacttgatgggaaaatc
ccggtgtccagagggtttcctatcgctgaagtgttcacgctgaagcccctggagtttggc
aagcccaacactttggtctgttttgtcagtaatctcttcccacccatgctgacagtgaac
tggcagcatcattccgtccctgtggaaggatttgggcctacttttgtctcagctgtcgat
ggactcagcttccaggccttttcttacttaaacttcacaccagaaccttctgacattttc
tcctgcattgtgactcacgaaattgaccgctacacagcaattgcctattgggtaccccgg
aacgcactgccctcagatctgctggagaatgtgctgtgtggcgtggcctttggcctgggt
gtgctgggcatcatcgtgggcattgttctcatcatctacttccggaagccttgctcaggt
gactga

KEGG   Homo sapiens (human): 3109
Entry
3109              CDS       T01001                                 
Symbol
HLA-DMB, D6S221E, RING7
Name
(RefSeq) major histocompatibility complex, class II, DM beta
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3109 (HLA-DMB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3109 (HLA-DMB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3109 (HLA-DMB)
   04612 Antigen processing and presentation
    3109 (HLA-DMB)
   04658 Th1 and Th2 cell differentiation
    3109 (HLA-DMB)
   04659 Th17 cell differentiation
    3109 (HLA-DMB)
   04672 Intestinal immune network for IgA production
    3109 (HLA-DMB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3109 (HLA-DMB)
   05164 Influenza A
    3109 (HLA-DMB)
   05168 Herpes simplex virus 1 infection
    3109 (HLA-DMB)
   05169 Epstein-Barr virus infection
    3109 (HLA-DMB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3109 (HLA-DMB)
   05152 Tuberculosis
    3109 (HLA-DMB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3109 (HLA-DMB)
   05140 Leishmaniasis
    3109 (HLA-DMB)
  09163 Immune disease
   05310 Asthma
    3109 (HLA-DMB)
   05322 Systemic lupus erythematosus
    3109 (HLA-DMB)
   05323 Rheumatoid arthritis
    3109 (HLA-DMB)
   05320 Autoimmune thyroid disease
    3109 (HLA-DMB)
   05321 Inflammatory bowel disease
    3109 (HLA-DMB)
   05330 Allograft rejection
    3109 (HLA-DMB)
   05332 Graft-versus-host disease
    3109 (HLA-DMB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3109 (HLA-DMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3109 (HLA-DMB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3109 (HLA-DMB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3109 (HLA-DMB)
  Exosomal proteins of epithelial cells
   3109 (HLA-DMB)
  Exosomal proteins of breast milk
   3109 (HLA-DMB)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Ig_2 C2-set_2 I-set SPARK ig
Other DBs
NCBI-GeneID: 3109
NCBI-ProteinID: NP_002109
OMIM: 142856
HGNC: 4935
Ensembl: ENSG00000242574
Pharos: P28068(Tbio)
UniProt: P28068 A0A1V0E3P2
Structure
LinkDB
Position
6:complement(32934636..32941028)
AA seq 263 aa
MITFLPLLLGLSLGCTGAGGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENK
MAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVA
KTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHL
ALTPSYGDTYTCVVEHTGAPEPILRDWTPGLSPMQTLKVSVSAVTLGLGLIIFSLGVISW
RRAGHSSYTPLPGSNYSEGWHIS
NT seq 792 nt   +upstreamnt  +downstreamnt
atgatcacattcctgccgctgctgctggggctcagcctgggctgcacaggagcaggtggc
ttcgtggcccatgtggaaagcacctgtctgttggatgatgctgggactccaaaggatttc
acatactgcatctccttcaacaaggatctgctgacctgctgggatccagaggagaataag
atggccccttgcgaatttggggtgctgaatagcttggcgaatgtcctctcacagcacctc
aaccaaaaagacaccctgatgcagcgcttgcgcaatgggcttcagaattgtgccacacac
acccagcccttctggggatcactgaccaacaggacacggccaccatctgtgcaagtagcc
aaaaccactccttttaacacgagggagcctgtgatgctggcctgctatgtgtggggcttc
tatccagcagaagtgactatcacgtggaggaagaacgggaagcttgtcatgcctcacagc
agtgcgcacaagactgcccagcccaatggagactggacataccagaccctctcccattta
gccttaaccccctcttacggggacacttacacctgtgtggtagagcacactggggctcct
gagcccatccttcgggactggacacctgggctgtcccccatgcagaccctgaaggtttct
gtgtctgcagtgactctgggcctgggcctcatcatcttctctcttggtgtgatcagctgg
cggagagctggccactctagttacactcctcttcctgggtccaattattcagaaggatgg
cacatttcctag

KEGG   Homo sapiens (human): 3111
Entry
3111              CDS       T01001                                 
Symbol
HLA-DOA, HLA-DNA, HLA-DZA, HLADZ
Name
(RefSeq) major histocompatibility complex, class II, DO alpha
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3111 (HLA-DOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3111 (HLA-DOA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3111 (HLA-DOA)
   04612 Antigen processing and presentation
    3111 (HLA-DOA)
   04658 Th1 and Th2 cell differentiation
    3111 (HLA-DOA)
   04659 Th17 cell differentiation
    3111 (HLA-DOA)
   04672 Intestinal immune network for IgA production
    3111 (HLA-DOA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3111 (HLA-DOA)
   05164 Influenza A
    3111 (HLA-DOA)
   05168 Herpes simplex virus 1 infection
    3111 (HLA-DOA)
   05169 Epstein-Barr virus infection
    3111 (HLA-DOA)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3111 (HLA-DOA)
   05152 Tuberculosis
    3111 (HLA-DOA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3111 (HLA-DOA)
   05140 Leishmaniasis
    3111 (HLA-DOA)
  09163 Immune disease
   05310 Asthma
    3111 (HLA-DOA)
   05322 Systemic lupus erythematosus
    3111 (HLA-DOA)
   05323 Rheumatoid arthritis
    3111 (HLA-DOA)
   05320 Autoimmune thyroid disease
    3111 (HLA-DOA)
   05321 Inflammatory bowel disease
    3111 (HLA-DOA)
   05330 Allograft rejection
    3111 (HLA-DOA)
   05332 Graft-versus-host disease
    3111 (HLA-DOA)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3111 (HLA-DOA)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3111 (HLA-DOA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3111 (HLA-DOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3111 (HLA-DOA)
  Exosomal proteins of epithelial cells
   3111 (HLA-DOA)
  Exosomal proteins of breast milk
   3111 (HLA-DOA)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2
Other DBs
NCBI-GeneID: 3111
NCBI-ProteinID: NP_002110
OMIM: 142930
HGNC: 4936
Ensembl: ENSG00000204252
Pharos: P06340(Tbio)
UniProt: P06340 X5CF87 A0A1V0E3Q8 A0A1V0E3N1 A0A1V0E3Q5 A0A1V0E3M7 A0A1V0E3R3 A0A1V0E3S6 A0A1V0E3Q2 A0A1V0E3S7 A0A1V0E3T1 A0A1V0E3P6 A0A1V0E3P8 A0A1V0E3P1 A0A1V0E3P3 A0A1V0E3Q6 A0A1V0E3P9 A0A1V0E3R6 A0A1V0E3N7 A0A1V0E3S0 A0A1V0E3N3 A0A1V0E3Q1 A0A1V0E3P0 A0A1V0E3R4 A0A1V0E3R8 A0A1V0E3Q4 A0A1V0E3N6 A0A1V0E3R0 A0A1V0E3S4 A0A1V0E3Q7 A0A1V0E3Q3
Structure
LinkDB
Position
6:complement(33004182..33009591)
AA seq 250 aa
MALRAGLVLGFHTLMTLLSPQEAGATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSV
DLKKSEAVWRLPEFGDFARFDPQGGLAGIAAIKAHLDILVERSNRSRAINVPPRVTVLPK
SRVELGQPNILICIVDNIFPPVINITWLRNGQTVTEGVAQTSFYSQPDHLFRKFHYLPFV
PSAEDVYDCQVEHWGLDAPLLRHWELQVPIPPPDAMETLVCALGLAIGLVGFLVGTVLII
MGTYVSSVPR
NT seq 753 nt   +upstreamnt  +downstreamnt
atggccctcagagcagggctggtcctggggttccacaccctgatgaccctcctgagcccg
caggaggcaggggccaccaaggctgaccacatgggctcctacggacccgccttctaccag
tcttacggcgcctcgggccagttcacccatgaatttgatgaggaacagctgttctctgtg
gacctgaagaaaagcgaggccgtgtggcgtctgcctgagtttggtgactttgcccgcttt
gacccgcagggcgggctggccggcatcgccgcaatcaaagcccatctggacatcctggtg
gagcgctccaaccgcagcagagccatcaacgtgcctccacgggtgaccgtgctccccaag
tctcgggtggagctgggccagcccaacatcctcatctgcatcgtggacaacatcttcccc
cctgtgatcaatatcacctggctgcgcaacggccaaactgtcactgagggagtggcccag
accagcttctattcccagcctgaccatttgttccgcaagttccactacctgcccttcgtg
ccctcagccgaggacgtctatgactgccaggtggagcactggggcctggatgcgccactc
ctcaggcattgggagctccaggtgcctattccaccaccagatgccatggagaccctggtc
tgtgccctgggcctggccatcggcctggtgggcttcctcgtgggcaccgtcctcatcatc
atgggcacatatgtgtccagtgtccccaggtaa

KEGG   Homo sapiens (human): 3112
Entry
3112              CDS       T01001                                 
Symbol
HLA-DOB, DOB, HLA_DOB
Name
(RefSeq) major histocompatibility complex, class II, DO beta
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3112 (HLA-DOB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3112 (HLA-DOB)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3112 (HLA-DOB)
   04612 Antigen processing and presentation
    3112 (HLA-DOB)
   04658 Th1 and Th2 cell differentiation
    3112 (HLA-DOB)
   04659 Th17 cell differentiation
    3112 (HLA-DOB)
   04672 Intestinal immune network for IgA production
    3112 (HLA-DOB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3112 (HLA-DOB)
   05164 Influenza A
    3112 (HLA-DOB)
   05168 Herpes simplex virus 1 infection
    3112 (HLA-DOB)
   05169 Epstein-Barr virus infection
    3112 (HLA-DOB)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3112 (HLA-DOB)
   05152 Tuberculosis
    3112 (HLA-DOB)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3112 (HLA-DOB)
   05140 Leishmaniasis
    3112 (HLA-DOB)
  09163 Immune disease
   05310 Asthma
    3112 (HLA-DOB)
   05322 Systemic lupus erythematosus
    3112 (HLA-DOB)
   05323 Rheumatoid arthritis
    3112 (HLA-DOB)
   05320 Autoimmune thyroid disease
    3112 (HLA-DOB)
   05321 Inflammatory bowel disease
    3112 (HLA-DOB)
   05330 Allograft rejection
    3112 (HLA-DOB)
   05332 Graft-versus-host disease
    3112 (HLA-DOB)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3112 (HLA-DOB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3112 (HLA-DOB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3112 (HLA-DOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3112 (HLA-DOB)
  Exosomal proteins of epithelial cells
   3112 (HLA-DOB)
  Exosomal proteins of breast milk
   3112 (HLA-DOB)
SSDB
Motif
Pfam: MHC_II_beta C1-set ig C2-set_2 MHC_I
Other DBs
NCBI-GeneID: 3112
NCBI-ProteinID: NP_002111
OMIM: 600629
HGNC: 4937
Ensembl: ENSG00000241106
Pharos: P13765(Tbio)
UniProt: P13765 Q5QNS2
Structure
LinkDB
Position
6:complement(32812763..32817002)
AA seq 273 aa
MGSGWVPWVVALLVNLTRLDSSMTQGTDSPEDFVIQAKADCYFTNGTEKVQFVVRFIFNL
EEYVRFDSDVGMFVALTKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRK
VQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGDWT
FQTVVMLEMTPELGHVYTCLVDHSSLLSPVSVEWRAQSEYSWRKMLSGIAAFLLGLIFLL
VGIVIQLRAQKGYVRTQMSGNEVSRAVLLPQSC
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggttctgggtgggtcccctgggtggtggctctgctagtgaatctgacccgactggat
tcctccatgactcaaggcacagactctccagaagattttgtgattcaggcaaaggctgac
tgttacttcaccaacgggacagaaaaggtgcagtttgtggtcagattcatctttaacttg
gaggagtatgtacgtttcgacagtgatgtggggatgtttgtggcattgaccaagctgggg
cagccagatgctgagcagtggaacagccggctggatctcttggagaggagcagacaggcc
gtggatggggtctgtagacacaactacaggctgggcgcacccttcactgtggggagaaaa
gtgcaaccagaggtgacagtgtacccagagaggaccccactcctgcaccagcataatctg
ctgcactgctctgtgacaggcttctatccaggggatatcaagatcaagtggttcctgaat
gggcaggaggagagagctggggtcatgtccactggccctatcaggaatggagactggacc
tttcagactgtggtgatgctagaaatgactcctgaacttggacatgtctacacctgcctt
gtcgatcactccagcctgctgagccctgtttctgtggagtggagagctcagtctgaatat
tcttggagaaagatgctgagtggcattgcagccttcctacttgggctaatcttccttctg
gtgggaatcgtcatccagctaagggctcagaaaggatatgtgaggacgcagatgtctggt
aatgaggtctcaagagctgttctgctccctcagtcatgctaa

KEGG   Homo sapiens (human): 3113
Entry
3113              CDS       T01001                                 
Symbol
HLA-DPA1, DP(W3), DP(W4), DPA1, HLA-DP1A, HLA-DPA, HLA-DPB1, HLADP, HLASB, PLT1
Name
(RefSeq) major histocompatibility complex, class II, DP alpha 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00294  Dilated cardiomyopathy
H01492  Systemic sclerosis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3113 (HLA-DPA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3113 (HLA-DPA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3113 (HLA-DPA1)
   04612 Antigen processing and presentation
    3113 (HLA-DPA1)
   04658 Th1 and Th2 cell differentiation
    3113 (HLA-DPA1)
   04659 Th17 cell differentiation
    3113 (HLA-DPA1)
   04672 Intestinal immune network for IgA production
    3113 (HLA-DPA1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3113 (HLA-DPA1)
   05164 Influenza A
    3113 (HLA-DPA1)
   05168 Herpes simplex virus 1 infection
    3113 (HLA-DPA1)
   05169 Epstein-Barr virus infection
    3113 (HLA-DPA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3113 (HLA-DPA1)
   05152 Tuberculosis
    3113 (HLA-DPA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3113 (HLA-DPA1)
   05140 Leishmaniasis
    3113 (HLA-DPA1)
  09163 Immune disease
   05310 Asthma
    3113 (HLA-DPA1)
   05322 Systemic lupus erythematosus
    3113 (HLA-DPA1)
   05323 Rheumatoid arthritis
    3113 (HLA-DPA1)
   05320 Autoimmune thyroid disease
    3113 (HLA-DPA1)
   05321 Inflammatory bowel disease
    3113 (HLA-DPA1)
   05330 Allograft rejection
    3113 (HLA-DPA1)
   05332 Graft-versus-host disease
    3113 (HLA-DPA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3113 (HLA-DPA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3113 (HLA-DPA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3113 (HLA-DPA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3113 (HLA-DPA1)
  Exosomal proteins of epithelial cells
   3113 (HLA-DPA1)
  Exosomal proteins of breast milk
   3113 (HLA-DPA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3
Other DBs
NCBI-GeneID: 3113
NCBI-ProteinID: NP_001229453
OMIM: 142880
HGNC: 4938
Ensembl: ENSG00000231389
Pharos: P20036(Tbio)
UniProt: P20036 X5CKE2
Structure
LinkDB
Position
6:complement(33064569..33080748)
AA seq 260 aa
MRPEDRMFHIRAVILRALSLAFLLSLRGAGAIKADHVSTYAAFVQTHRPTGEFMFEFDED
EMFYVDLDKKETVWHLEEFGQAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATNDPPEV
TVFPKEPVELGQPNTLICHIDKFFPPVLNVTWLCNGELVTEGVAESLFLPRTDYSFHKFH
YLTFVPSAEDFYDCRVEHWGLDQPLLKHWEAQEPIQMPETTETVLCALGLVLGLVGIIVG
TVLIIKSLRSGHDPRAQGTL
NT seq 783 nt   +upstreamnt  +downstreamnt
atgcgccctgaagacagaatgttccatatcagagctgtgatcttgagagccctctccttg
gctttcctgctgagtctccgaggagctggggccatcaaggcggaccatgtgtcaacttat
gccgcgtttgtacagacgcatagaccaacaggggagtttatgtttgaatttgatgaagat
gagatgttctatgtggatctggacaagaaggagaccgtctggcatctggaggagtttggc
caagccttttcctttgaggctcagggcgggctggctaacattgctatattgaacaacaac
ttgaataccttgatccagcgttccaaccacactcaggccaccaacgatccccctgaggtg
accgtgtttcccaaggagcctgtggagctgggccagcccaacaccctcatctgccacatt
gacaagttcttcccaccagtgctcaacgtcacgtggctgtgcaacggggagctggtcact
gagggtgtcgctgagagcctcttcctgcccagaacagattacagcttccacaagttccat
tacctgacctttgtgccctcagcagaggacttctatgactgcagggtggagcactggggc
ttggaccagccgctcctcaagcactgggaggcccaagagccaatccagatgcctgagaca
acggagactgtgctctgtgccctgggcctggtgctgggcctagtcggcatcatcgtgggc
accgtcctcatcataaagtctctgcgttctggccatgacccccgggcccaggggaccctg
tga

KEGG   Homo sapiens (human): 3115
Entry
3115              CDS       T01001                                 
Symbol
HLA-DPB1, DPB1, HLA-DP, HLA-DP1B, HLA-DPB
Name
(RefSeq) major histocompatibility complex, class II, DP beta 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00294  Dilated cardiomyopathy
H01492  Systemic sclerosis
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3115 (HLA-DPB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3115 (HLA-DPB1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3115 (HLA-DPB1)
   04612 Antigen processing and presentation
    3115 (HLA-DPB1)
   04658 Th1 and Th2 cell differentiation
    3115 (HLA-DPB1)
   04659 Th17 cell differentiation
    3115 (HLA-DPB1)
   04672 Intestinal immune network for IgA production
    3115 (HLA-DPB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3115 (HLA-DPB1)
   05164 Influenza A
    3115 (HLA-DPB1)
   05168 Herpes simplex virus 1 infection
    3115 (HLA-DPB1)
   05169 Epstein-Barr virus infection
    3115 (HLA-DPB1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3115 (HLA-DPB1)
   05152 Tuberculosis
    3115 (HLA-DPB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3115 (HLA-DPB1)
   05140 Leishmaniasis
    3115 (HLA-DPB1)
  09163 Immune disease
   05310 Asthma
    3115 (HLA-DPB1)
   05322 Systemic lupus erythematosus
    3115 (HLA-DPB1)
   05323 Rheumatoid arthritis
    3115 (HLA-DPB1)
   05320 Autoimmune thyroid disease
    3115 (HLA-DPB1)
   05321 Inflammatory bowel disease
    3115 (HLA-DPB1)
   05330 Allograft rejection
    3115 (HLA-DPB1)
   05332 Graft-versus-host disease
    3115 (HLA-DPB1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3115 (HLA-DPB1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3115 (HLA-DPB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3115 (HLA-DPB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3115 (HLA-DPB1)
  Exosomal proteins of epithelial cells
   3115 (HLA-DPB1)
  Exosomal proteins of breast milk
   3115 (HLA-DPB1)
SSDB
Motif
Pfam: MHC_II_beta C1-set Ig_3 Marek_A ig C2-set_2 Ig_2
Other DBs
NCBI-GeneID: 3115
NCBI-ProteinID: NP_002112
OMIM: 142858
HGNC: 4940
Ensembl: ENSG00000223865
Pharos: P04440(Tbio)
UniProt: P04440 I4EC15
Structure
LinkDB
Position
6:33075990..33089696
AA seq 258 aa
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYN
REEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQR
RVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDW
TFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIIC
GVGIFMHRRSKKVQRGSA
NT seq 777 nt   +upstreamnt  +downstreamnt
atgatggttctgcaggtttctgcggccccccggacagtggctctgacggcgttactgatg
gtgctgctcacatctgtggtccagggcagggccactccagagaattaccttttccaggga
cggcaggaatgctacgcgtttaatgggacacagcgcttcctggagagatacatctacaac
cgggaggagttcgcgcgcttcgacagcgacgtgggggagttccgggcggtgacggagctg
gggcggcctgctgcggagtactggaacagccagaaggacatcctggaggagaagcgggca
gtgccggacaggatgtgcagacacaactacgagctgggcgggcccatgaccctgcagcgc
cgagtccagcctagggtgaatgtttccccctccaagaaggggcccttgcagcaccacaac
ctgcttgtctgccacgtgacggatttctacccaggcagcattcaagtccgatggttcctg
aatggacaggaggaaacagctggggtcgtgtccaccaacctgatccgtaatggagactgg
accttccagatcctggtgatgctggaaatgaccccccagcagggagatgtctacacctgc
caagtggagcacaccagcctggatagtcctgtcaccgtggagtggaaggcacagtctgat
tctgcccggagtaagacattgacgggagctgggggcttcgtgctggggctcatcatctgt
ggagtgggcatcttcatgcacaggaggagcaagaaagttcaacgaggatctgcataa

KEGG   Homo sapiens (human): 3117
Entry
3117              CDS       T01001                                 
Symbol
HLA-DQA1, CELIAC1, DQ-A1, DQA1, HLA-DQA, HLA-DQB1
Name
(RefSeq) major histocompatibility complex, class II, DQ alpha 1
  KO
K06752  MHC class II antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04514  Cell adhesion molecules
hsa04612  Antigen processing and presentation
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04672  Intestinal immune network for IgA production
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05310  Asthma
hsa05320  Autoimmune thyroid disease
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06140  Transcription (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00508  HTLV-1 Tax to NFY-mediated transcription
N00590  Antigen processing and presentation by MHC class II molecules
Disease
H00080  Systemic lupus erythematosus
H00081  Hashimoto thyroiditis
H00082  Graves disease
H00294  Dilated cardiomyopathy
H00408  Type 1 diabetes mellitus
H01362  Dermatitis herpetiformis
H01492  Systemic sclerosis
H02123  Celiac disease
Drug target
Glatiramer acetate: D04318<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    3117 (HLA-DQA1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    3117 (HLA-DQA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3117 (HLA-DQA1)
   04612 Antigen processing and presentation
    3117 (HLA-DQA1)
   04658 Th1 and Th2 cell differentiation
    3117 (HLA-DQA1)
   04659 Th17 cell differentiation
    3117 (HLA-DQA1)
   04672 Intestinal immune network for IgA production
    3117 (HLA-DQA1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3117 (HLA-DQA1)
   05164 Influenza A
    3117 (HLA-DQA1)
   05168 Herpes simplex virus 1 infection
    3117 (HLA-DQA1)
   05169 Epstein-Barr virus infection
    3117 (HLA-DQA1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    3117 (HLA-DQA1)
   05152 Tuberculosis
    3117 (HLA-DQA1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    3117 (HLA-DQA1)
   05140 Leishmaniasis
    3117 (HLA-DQA1)
  09163 Immune disease
   05310 Asthma
    3117 (HLA-DQA1)
   05322 Systemic lupus erythematosus
    3117 (HLA-DQA1)
   05323 Rheumatoid arthritis
    3117 (HLA-DQA1)
   05320 Autoimmune thyroid disease
    3117 (HLA-DQA1)
   05321 Inflammatory bowel disease
    3117 (HLA-DQA1)
   05330 Allograft rejection
    3117 (HLA-DQA1)
   05332 Graft-versus-host disease
    3117 (HLA-DQA1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3117 (HLA-DQA1)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3117 (HLA-DQA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3117 (HLA-DQA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3117 (HLA-DQA1)
  Exosomal proteins of epithelial cells
   3117 (HLA-DQA1)
  Exosomal proteins of breast milk
   3117 (HLA-DQA1)
SSDB
Motif
Pfam: MHC_II_alpha C1-set Ig_3 C2-set_2 I-set
Other DBs
NCBI-GeneID: 3117
NCBI-ProteinID: NP_002113
OMIM: 146880
HGNC: 4942
Ensembl: ENSG00000196735
Pharos: P01909(Tbio)
UniProt: P01909 A0A173ADG5 Q8MH44
Structure
LinkDB
Position
6:32637406..32655272
AA seq 255 aa
MILNKALLLGALALTTVMSPCGGEDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEQFYV
DLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATNEVPEVTVFSK
SPVTLGQPNTLICLVDNIFPPVVNITWLSNGQSVTEGVSETSFLSKSDHSFFKISYLTFL
PSADEIYDCKVEHWGLDQPLLKHWEPEIPAPMSELTETVVCALGLSVGLMGIVVGTVFII
QGLRSVGASRHQGPL
NT seq 768 nt   +upstreamnt  +downstreamnt
atgatcctaaacaaagctctgctgctgggggccctcgctctgaccaccgtgatgagcccc
tgtggaggtgaagacattgtggctgaccacgttgcctcttgtggtgtaaacttgtaccag
ttttacggtccctctggccagtacacccatgaatttgatggagatgagcagttctacgtg
gacctggagaggaaggagactgcctggcggtggcctgagttcagcaaatttggaggtttt
gacccgcagggtgcactgagaaacatggctgtggcaaaacacaacttgaacatcatgatt
aaacgctacaactctaccgctgctaccaatgaggttcctgaggtcacagtgttttccaag
tctcccgtgacactgggtcagcccaacaccctcatttgtcttgtggacaacatctttcct
cctgtggtcaacatcacatggctgagcaatgggcagtcagtcacagaaggtgtttctgag
accagcttcctctccaagagtgatcattccttcttcaagatcagttacctcaccttcctc
ccttctgctgatgagatttatgactgcaaggtggagcactggggcctggaccagcctctt
ctgaaacactgggagcctgagattccagcccctatgtcagagctcacagagactgtggtc
tgtgccctggggttgtctgtgggcctcatgggcattgtggtgggcactgtcttcatcatc
caaggcctgcgttcagttggtgcttccagacaccaagggccattgtga

DBGET integrated database retrieval system