KEGG   Homo sapiens (human): 3592
Entry
3592              CDS       T01001                                 
Symbol
IL12A, CLMF, IL-12A, NFSK, NKSF1, P35
Name
(RefSeq) interleukin 12A
  KO
K05406  interleukin 12A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04936  Alcoholic liver disease
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
hsa05330  Allograft rejection
hsa05417  Lipid and atherosclerosis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06183  Yersinia
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06517  TLR signaling
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00435  TLR1/2/4-NFKB signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01557  IL12/23 to Jak-STAT signaling pathway
N01566  TLR5-NFKB signaling pathway
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3592 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3592 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3592 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    3592 (IL12A)
   04625 C-type lectin receptor signaling pathway
    3592 (IL12A)
   04658 Th1 and Th2 cell differentiation
    3592 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3592 (IL12A)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    3592 (IL12A)
   05164 Influenza A
    3592 (IL12A)
   05162 Measles
    3592 (IL12A)
   05168 Herpes simplex virus 1 infection
    3592 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3592 (IL12A)
   05134 Legionellosis
    3592 (IL12A)
   05152 Tuberculosis
    3592 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3592 (IL12A)
   05144 Malaria
    3592 (IL12A)
   05145 Toxoplasmosis
    3592 (IL12A)
   05140 Leishmaniasis
    3592 (IL12A)
   05142 Chagas disease
    3592 (IL12A)
   05143 African trypanosomiasis
    3592 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3592 (IL12A)
   05330 Allograft rejection
    3592 (IL12A)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3592 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3592 (IL12A)
   04936 Alcoholic liver disease
    3592 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3592 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3592 (IL12A)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   3592 (IL12A)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Cytokines
   3592 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 3592
NCBI-ProteinID: NP_000873
OMIM: 161560
HGNC: 5969
Ensembl: ENSG00000168811
UniProt: P29459 O60595
Structure
LinkDB
Position
3:159988835..159996019
AA seq 253 aa
MWPPGSASQPPPSPAAATGLHPAARPVSLQCRLSMCPARSLLLVATLVLLDHLSLARNLP
VATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACL
PLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLL
MDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRA
VTIDRVMSYLNAS
NT seq 762 nt   +upstreamnt  +downstreamnt
atgtggccccctgggtcagcctcccagccaccgccctcacctgccgcggccacaggtctg
catccagcggctcgccctgtgtccctgcagtgccggctcagcatgtgtccagcgcgcagc
ctcctccttgtggctaccctggtcctcctggaccacctcagtttggccagaaacctcccc
gtggccactccagacccaggaatgttcccatgccttcaccactcccaaaacctgctgagg
gccgtcagcaacatgctccagaaggccagacaaactctagaattttacccttgcacttct
gaagagattgatcatgaagatatcacaaaagataaaaccagcacagtggaggcctgttta
ccattggaattaaccaagaatgagagttgcctaaattccagagagacctctttcataact
aatgggagttgcctggcctccagaaagacctcttttatgatggccctgtgccttagtagt
atttatgaagacttgaagatgtaccaggtggagttcaagaccatgaatgcaaagcttctg
atggatcctaagaggcagatctttctagatcaaaacatgctggcagttattgatgagctg
atgcaggccctgaatttcaacagtgagactgtgccacaaaaatcctcccttgaagaaccg
gatttttataaaactaaaatcaagctctgcatacttcttcatgctttcagaattcgggca
gtgactattgatagagtgatgagctatctgaatgcttcctaa

KEGG   Homo sapiens (human): 3593
Entry
3593              CDS       T01001                                 
Symbol
IL12B, CLMF, CLMF2, IL-12B, IMD28, IMD29, NKSF, NKSF2
Name
(RefSeq) interleukin 12B
  KO
K05425  interleukin 12B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04620  Toll-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04936  Alcoholic liver disease
hsa04940  Type I diabetes mellitus
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05162  Measles
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05321  Inflammatory bowel disease
hsa05330  Allograft rejection
hsa05417  Lipid and atherosclerosis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06171  SARS coronavirus 2 (SARS-CoV-2)
nt06183  Yersinia
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06517  TLR signaling
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00435  TLR1/2/4-NFKB signaling pathway
N01307  SARS-CoV-2 S to AngII-AT1R-NOX2 signaling pathway
N01557  IL12/23 to Jak-STAT signaling pathway
N01566  TLR5-NFKB signaling pathway
Disease
H00089  IFN-gamma/IL-12 axis
Drug target
Apilimod mesylate: D06556
Briakinumab: D09588
Lisofylline: D04748
Ustekinumab: D09214<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3593 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3593 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3593 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    3593 (IL12B)
   04625 C-type lectin receptor signaling pathway
    3593 (IL12B)
   04658 Th1 and Th2 cell differentiation
    3593 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3593 (IL12B)
   05205 Proteoglycans in cancer
    3593 (IL12B)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    3593 (IL12B)
   05164 Influenza A
    3593 (IL12B)
   05162 Measles
    3593 (IL12B)
   05168 Herpes simplex virus 1 infection
    3593 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    3593 (IL12B)
   05134 Legionellosis
    3593 (IL12B)
   05152 Tuberculosis
    3593 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3593 (IL12B)
   05145 Toxoplasmosis
    3593 (IL12B)
   05140 Leishmaniasis
    3593 (IL12B)
   05142 Chagas disease
    3593 (IL12B)
   05143 African trypanosomiasis
    3593 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    3593 (IL12B)
   05330 Allograft rejection
    3593 (IL12B)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3593 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3593 (IL12B)
   04936 Alcoholic liver disease
    3593 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    3593 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3593 (IL12B)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   3593 (IL12B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Cytokines
   3593 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_2 Ig_4 fn3 I-set ig
Other DBs
NCBI-GeneID: 3593
NCBI-ProteinID: NP_002178
OMIM: 161561
HGNC: 5970
Ensembl: ENSG00000113302
UniProt: P29460
Structure
LinkDB
Position
5:complement(159314780..159330487)
AA seq 328 aa
MCHQQLVISWFSLVFLASPLVAIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITW
TLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQ
KEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERV
RGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKN
LQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVIC
RKNASISVRAQDRYYSSSWSEWASVPCS
NT seq 987 nt   +upstreamnt  +downstreamnt
atgtgtcaccagcagttggtcatctcttggttttccctggtttttctggcatctcccctc
gtggccatatgggaactgaagaaagatgtttatgtcgtagaattggattggtatccggat
gcccctggagaaatggtggtcctcacctgtgacacccctgaagaagatggtatcacctgg
accttggaccagagcagtgaggtcttaggctctggcaaaaccctgaccatccaagtcaaa
gagtttggagatgctggccagtacacctgtcacaaaggaggcgaggttctaagccattcg
ctcctgctgcttcacaaaaaggaagatggaatttggtccactgatattttaaaggaccag
aaagaacccaaaaataagacctttctaagatgcgaggccaagaattattctggacgtttc
acctgctggtggctgacgacaatcagtactgatttgacattcagtgtcaaaagcagcaga
ggctcttctgacccccaaggggtgacgtgcggagctgctacactctctgcagagagagtc
agaggggacaacaaggagtatgagtactcagtggagtgccaggaggacagtgcctgccca
gctgctgaggagagtctgcccattgaggtcatggtggatgccgttcacaagctcaagtat
gaaaactacaccagcagcttcttcatcagggacatcatcaaacctgacccacccaagaac
ttgcagctgaagccattaaagaattctcggcaggtggaggtcagctgggagtaccctgac
acctggagtactccacattcctacttctccctgacattctgcgttcaggtccagggcaag
agcaagagagaaaagaaagatagagtcttcacggacaagacctcagccacggtcatctgc
cgcaaaaatgccagcattagcgtgcgggcccaggaccgctactatagctcatcttggagc
gaatgggcatctgtgccctgcagttag

KEGG   Homo sapiens (human): 51561
Entry
51561             CDS       T01001                                 
Symbol
IL23A, IL-23, IL-23A, IL23P19, P19, SGRF
Name
(RefSeq) interleukin 23 subunit alpha
  KO
K05426  interleukin 23 subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04625  C-type lectin receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
hsa04659  Th17 cell differentiation
hsa05133  Pertussis
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling (cancer)
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
nt06518  JAK-STAT signaling
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N01557  IL12/23 to Jak-STAT signaling pathway
Drug target
Apilimod mesylate: D06556
Brazikumab: D10912
Briakinumab: D09588
Guselkumab: D10438<JP/US>
Mirikizumab: D11123<JP/US>
Risankizumab: D11052<JP/US>
Tildrakizumab: D10400<JP/US>
Ustekinumab: D09214<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    51561 (IL23A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    51561 (IL23A)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    51561 (IL23A)
   04659 Th17 cell differentiation
    51561 (IL23A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    51561 (IL23A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    51561 (IL23A)
   05152 Tuberculosis
    51561 (IL23A)
  09163 Immune disease
   05323 Rheumatoid arthritis
    51561 (IL23A)
   05321 Inflammatory bowel disease
    51561 (IL23A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and neuropeptides [BR:hsa04052]
    51561 (IL23A)
Cytokines and neuropeptides [BR:hsa04052]
 Cytokines
  Interleukins
   51561 (IL23A)
SSDB
Motif
Pfam: IL23 IL6
Other DBs
NCBI-GeneID: 51561
NCBI-ProteinID: NP_057668
OMIM: 605580
HGNC: 15488
Ensembl: ENSG00000110944
UniProt: Q9NPF7
Structure
LinkDB
Position
12:56338884..56340410
AA seq 189 aa
MLGSRAVMLLLLLPWTAQGRAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEG
DEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSP
VGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVF
AHGAATLSP
NT seq 570 nt   +upstreamnt  +downstreamnt
atgctggggagcagagctgtaatgctgctgttgctgctgccctggacagctcagggcaga
gctgtgcctgggggcagcagccctgcctggactcagtgccagcagctttcacagaagctc
tgcacactggcctggagtgcacatccactagtgggacacatggatctaagagaagaggga
gatgaagagactacaaatgatgttccccatatccagtgtggagatggctgtgacccccaa
ggactcagggacaacagtcagttctgcttgcaaaggatccaccagggtctgattttttat
gagaagctgctaggatcggatattttcacaggggagccttctctgctccctgatagccct
gtgggccagcttcatgcctccctactgggcctcagccaactcctgcagcctgagggtcac
cactgggagactcagcagattccaagcctcagtcccagccagccatggcagcgtctcctt
ctccgcttcaaaatccttcgcagcctccaggcctttgtggctgtagccgcccgggtcttt
gcccatggagcagcaaccctgagtccctaa

DBGET integrated database retrieval system