KEGG   Homo sapiens (human): 4153
Entry
4153              CDS       T01001                                 

Gene name
MBL2, COLEC1, HSMBPC, MBL, MBL2D, MBP, MBP-C, MBP1, MBPD
Definition
(RefSeq) mannose binding lectin 2
  KO
K03991  mannose-binding lectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01315  Lectin pathway of coagulation activation
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation activation
Disease
H00105  Mannose-binding lectin pathway component defects
H00342  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4153 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    4153 (MBL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    4153 (MBL2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    4153 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4153 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    4153 (MBL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    4153 (MBL2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   4153 (MBL2)
SSDB
Motif
Pfam: Lectin_C Collagen
Other DBs
NCBI-GeneID: 4153
NCBI-ProteinID: NP_000233
OMIM: 154545
HGNC: 6922
Ensembl: ENSG00000165471
Vega: OTTHUMG00000150270
Pharos: P11226(Tbio)
UniProt: P11226
LinkDB
Structure
PDB: 
1HUP

Position
10q21.1
AA seq 248 aa
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
NT seq 747 nt   +upstreamnt  +downstreamnt
atgtccctgtttccatcactccctctccttctcctgagtatggtggcagcgtcttactca
gaaactgtgacctgtgaggatgcccaaaagacctgccctgcagtgattgcctgtagctct
ccaggcatcaacggcttcccaggcaaagatgggcgtgatggcaccaagggagaaaagggg
gaaccaggccaagggctcagaggcttacagggcccccctggaaagttggggcctccagga
aatccagggccttctgggtcaccaggaccaaagggccaaaaaggagaccctggaaaaagt
ccggatggtgatagtagcctggctgcctcagaaagaaaagctctgcaaacagaaatggca
cgtatcaaaaagtggctcaccttctctctgggcaaacaagttgggaacaagttcttcctg
accaatggtgaaataatgacctttgaaaaagtgaaggccttgtgtgtcaagttccaggcc
tctgtggccacccccaggaatgctgcagagaatggagccattcagaatctcatcaaggag
gaagccttcctgggcatcactgatgagaagacagaagggcagtttgtggatctgacagga
aatagactgacctacacaaactggaacgagggtgaacccaacaatgctggttctgatgaa
gattgtgtattgctactgaaaaatggccagtggaatgacgtcccctgctccacctcccat
ctggccgtctgtgagttccctatctga

KEGG   Homo sapiens (human): 5648
Entry
5648              CDS       T01001                                 

Gene name
MASP1, 3MC1, CRARF, CRARF1, MAP-1, MAP1, MASP, MASP-3, MASP3, MAp44, PRSS5, RaRF
Definition
(RefSeq) MBL associated serine protease 1
  KO
K03992  mannan-binding lectin serine protease 1 [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01315  Lectin pathway of coagulation activation
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation activation
Disease
H01887  3MC syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    5648 (MASP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    5648 (MASP1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    5648 (MASP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    5648 (MASP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     5648 (MASP1)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   5648 (MASP1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA cEGF Trypsin_2 CUB_2 Peptidase_S6 DUF1986
Other DBs
NCBI-GeneID: 5648
NCBI-ProteinID: NP_001870
OMIM: 600521
HGNC: 6901
Ensembl: ENSG00000127241
Vega: OTTHUMG00000156461
Pharos: P48740(Tbio)
UniProt: P48740
LinkDB
Structure
PDB: 

Position
3q27.3
AA seq 699 aa
MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKL
YFMHFNLESSYLCEYDYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRS
DFSNEERFTGFDAHYMAVDVDECKEREDEELSCDHYCHNYIGGYYCSCRFGYILHTDNRT
CRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVNLQFEDIFDIEDHPEV
PCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE
CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIP
TCKIVDCRAPGELEHGLITFSTRNNLTTYKSEIKYSCQEPYYKMLNNNTGIYTCSAQGVW
MNKVLGRSLPTCLPVCGLPKFSRKLMARIFNGRPAQKGTTPWIAMLSHLNGQPFCGGSLL
GSSWIVTAAHCLHQSLDPEDPTLRDSDLLSPSDFKIILGKHWRLRSDENEQHLGVKHTTL
HPQYDPNTFENDVALVELLESPVLNAFVMPICLPEGPQQEGAMVIVSGWGKQFLQRFPET
LMEIEIPIVDHSTCQKAYAPLKKKVTRDMICAGEKEGGKDACAGDSGGPMVTLNRERGQW
YLVGTVSWGDDCGKKDRYGVYSYIHHNKDWIQRVTGVRN
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgaggtggctgcttctctattatgctctgtgcttctccctgtcaaaggcttcagcccac
accgtggagctaaacaatatgtttggccagatccagtcgcctggttatccagactcctat
cccagtgattcagaggtgacttggaatatcactgtcccagatgggtttcggatcaagctt
tacttcatgcacttcaacttggaatcctcctacctttgtgaatatgactatgtgaaggta
gaaactgaggaccaggtgctggcaaccttctgtggcagggagaccacagacacagagcag
actcccggccaggaggtggtcctctcccctggctccttcatgtccatcactttccggtca
gatttctccaatgaggagcgtttcacaggctttgatgcccactacatggctgtggatgtg
gacgagtgcaaggagagggaggacgaggagctgtcctgtgaccactactgccacaactac
attggcggctactactgctcctgccgcttcggctacatcctccacacagacaacaggacc
tgccgagtggagtgcagtgacaacctcttcactcaaaggactggggtgatcaccagccct
gacttcccaaacccttaccccaagagctctgaatgcctgtataccatcgagctggaggag
ggtttcatggtcaacctgcagtttgaggacatatttgacattgaggaccatcctgaggtg
ccctgcccctatgactacatcaagatcaaagttggtccaaaagttttggggcctttctgt
ggagagaaagccccagaacccatcagcacccagagccacagtgtcctgatcctgttccat
agtgacaactcgggagagaaccggggctggaggctctcatacagggctgcaggaaatgag
tgcccagagctacagcctcctgtccatgggaaaatcgagccctcccaagccaagtatttc
ttcaaagaccaagtgctcgtcagctgtgacacaggctacaaagtgctgaaggataatgtg
gagatggacacattccagattgagtgtctgaaggatgggacgtggagtaacaagattccc
acctgtaaaattgtagactgtagagccccaggagagctggaacacgggctgatcaccttc
tctacaaggaacaacctcaccacatacaagtctgagatcaaatactcctgtcaggagccc
tattacaagatgctcaacaataacacaggtatatatacctgttctgcccaaggagtctgg
atgaataaagtattggggagaagcctacccacctgccttccagtgtgtgggctccccaag
ttctcccggaagctgatggccaggatcttcaatggacgcccagcccagaaaggcaccact
ccctggattgccatgctgtcacacctgaatgggcagcccttctgcggaggctcccttcta
ggctccagctggatcgtgaccgccgcacactgcctccaccagtcactcgatccggaagat
ccgaccctacgtgattcagacttgctcagcccttctgacttcaaaatcatcctgggcaag
cattggaggctccggtcagatgaaaatgaacagcatctcggcgtcaaacacaccactctc
cacccccagtatgatcccaacacattcgagaatgacgtggctctggtggagctgttggag
agcccagtgctgaatgccttcgtgatgcccatctgtctgcctgagggaccccagcaggaa
ggagccatggtcatcgtcagcggctgggggaagcagttcttgcaaaggttcccagagacc
ctgatggagattgaaatcccgattgttgaccacagcacctgccagaaggcttatgccccg
ctgaagaagaaagtgaccagggacatgatctgtgctggggagaaggaagggggaaaggac
gcctgtgcgggtgactctggaggccccatggtgaccctgaatagagaaagaggccagtgg
tacctggtgggcactgtgtcctggggtgatgactgtgggaagaaggaccgctacggagta
tactcttacatccaccacaacaaggactggatccagagggtcaccggagtgaggaactga

KEGG   Homo sapiens (human): 10747
Entry
10747             CDS       T01001                                 

Gene name
MASP2, MAP-2, MAP19, MASP-2, MASP1P1, sMAP
Definition
(RefSeq) MBL associated serine protease 2
  KO
K03993  mannan-binding lectin serine protease 2 [EC:3.4.21.104]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01311  Lectin pathway of complement activation
N01312  SARS-CoV-2 S to lectin pathway of complement activation
N01315  Lectin pathway of coagulation activation
N01316  SARS-CoV-2 S/N to lectin pathway of coagulation activation
Disease
H00105  Mannose-binding lectin pathway component defects
Drug target
Narsoplimab: D11531
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    10747 (MASP2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    10747 (MASP2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    10747 (MASP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    10747 (MASP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.104  mannan-binding lectin-associated serine protease-2
     10747 (MASP2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   10747 (MASP2)
SSDB
Motif
Pfam: Trypsin CUB Sushi EGF_CA FXa_inhibition cEGF CUB_2 EGF
Other DBs
NCBI-GeneID: 10747
NCBI-ProteinID: NP_006601
OMIM: 605102
HGNC: 6902
Ensembl: ENSG00000009724
Vega: OTTHUMG00000002121
Pharos: O00187(Tbio)
UniProt: O00187
LinkDB
Structure
PDB: 

Position
1p36.22
AA seq 686 aa
MRLLTLLGLLCGSVATPLGPKWPEPVFGRLASPGFPGEYANDQERRWTLTAPPGYRLRLY
FTHFDLELSHLCEYDFVKLSSGAKVLATLCGQESTDTERAPGKDTFYSLGSSLDITFRSD
YSNEKPFTGFEAFYAAEDIDECQVAPGEAPTCDHHCHNHLGGFYCSCRAGYVLHRNKRTC
SALCSGQVFTQRSGELSSPEYPRPYPKLSSCTYSISLEEGFSVILDFVESFDVETHPETL
CPYDFLKIQTDREEHGPFCGKTLPHRIETKSNTVTITFVTDESGDHTGWKIHYTSTAQPC
PYPMAPPNGHVSPVQAKYILKDSFSIFCETGYELLQGHLPLKSFTAVCQKDGSWDRPMPA
CSIVDCGPPDDLPSGRVEYITGPGVTTYKAVIQYSCEETFYTMKVNDGKYVCEADGFWTS
SKGEKSLPVCEPVCGLSARTTGGRIYGGQKAKPGDFPWQVLILGGTTAAGALLYDNWVLT
AAHAVYEQKHDASALDIRMGTLKRLSPHYTQAWSEAVFIHEGYTHDAGFDNDIALIKLNN
KVVINSNITPICLPRKEAESFMRTDDIGTASGWGLTQRGFLARNLMYVDIPIVDHQKCTA
AYEKPPYPRGSVTANMLCAGLESGGKDSCRGDSGGALVFLDSETERWFVGGIVSWGSMNC
GEAGQYGVYTKVINYIPWIENIISDF
NT seq 2061 nt   +upstreamnt  +downstreamnt
atgaggctgctgaccctcctgggccttctgtgtggctcggtggccacccccttgggcccg
aagtggcctgaacctgtgttcgggcgcctggcatcccccggctttccaggggagtatgcc
aatgaccaggagcggcgctggaccctgactgcaccccccggctaccgcctgcgcctctac
ttcacccacttcgacctggagctctcccacctctgcgagtacgacttcgtcaagctgagc
tcgggggccaaggtgctggccacgctgtgcgggcaggagagcacagacacggagcgggcc
cctggcaaggacactttctactcgctgggctccagcctggacattaccttccgctccgac
tactccaacgagaagccgttcacggggttcgaggccttctatgcagccgaggacattgac
gagtgccaggtggccccgggagaggcgcccacctgcgaccaccactgccacaaccacctg
ggcggtttctactgctcctgccgcgcaggctacgtcctgcaccgtaacaagcgcacctgc
tcagccctgtgctccggccaggtcttcacccagaggtctggggagctcagcagccctgaa
tacccacggccgtatcccaaactctccagttgcacttacagcatcagcctggaggagggg
ttcagtgtcattctggactttgtggagtccttcgatgtggagacacaccctgaaaccctg
tgtccctacgactttctcaagattcaaacagacagagaagaacatggcccattctgtggg
aagacattgccccacaggattgaaacaaaaagcaacacggtgaccatcacctttgtcaca
gatgaatcaggagaccacacaggctggaagatccactacacgagcacagcgcagccttgc
ccttatccgatggcgccacctaatggccacgtttcacctgtgcaagccaaatacatcctg
aaagacagcttctccatcttttgcgagactggctatgagcttctgcaaggtcacttgccc
ctgaaatcctttactgcagtttgtcagaaagatggatcttgggaccggccaatgcccgcg
tgcagcattgttgactgtggccctcctgatgatctacccagtggccgagtggagtacatc
acaggtcctggagtgaccacctacaaagctgtgattcagtacagctgtgaagagaccttc
tacacaatgaaagtgaatgatggtaaatatgtgtgtgaggctgatggattctggacgagc
tccaaaggagaaaaatcactcccagtctgtgagcctgtttgtggactatcagcccgcaca
acaggagggcgtatatatggagggcaaaaggcaaaacctggtgattttccttggcaagtc
ctgatattaggtggaaccacagcagcaggtgcacttttatatgacaactgggtcctaaca
gctgctcatgccgtctatgagcaaaaacatgatgcatccgccctggacattcgaatgggc
accctgaaaagactatcacctcattatacacaagcctggtctgaagctgtttttatacat
gaaggttatactcatgatgctggctttgacaatgacatagcactgattaaattgaataac
aaagttgtaatcaatagcaacatcacgcctatttgtctgccaagaaaagaagctgaatcc
tttatgaggacagatgacattggaactgcatctggatggggattaacccaaaggggtttt
cttgctagaaatctaatgtatgtcgacataccgattgttgaccatcaaaaatgtactgct
gcatatgaaaagccaccctatccaaggggaagtgtaactgctaacatgctttgtgctggc
ttagaaagtgggggcaaggacagctgcagaggtgacagcggaggggcactggtgtttcta
gatagtgaaacagagaggtggtttgtgggaggaatagtgtcctggggttccatgaattgt
ggggaagcaggtcagtatggagtctacacaaaagttattaactatattccctggatcgag
aacataattagtgatttttaa

DBGET integrated database retrieval system