KEGG   Homo sapiens (human): 5519
Entry
5519              CDS       T01001                                 
Symbol
PPP2R1B, PP2A-Abeta, PR65B
Name
(RefSeq) protein phosphatase 2 scaffold subunit Abeta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Disease
H00013  Small cell lung cancer
H00014  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5519 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5519 (PPP2R1B)
   04390 Hippo signaling pathway
    5519 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    5519 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    5519 (PPP2R1B)
   04152 AMPK signaling pathway
    5519 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5519 (PPP2R1B)
   04114 Oocyte meiosis
    5519 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5519 (PPP2R1B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5519 (PPP2R1B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5519 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5519 (PPP2R1B)
   04730 Long-term depression
    5519 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5519 (PPP2R1B)
   05165 Human papillomavirus infection
    5519 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5519 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5519 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5519 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5519 (PPP2R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5519 (PPP2R1B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5519 (PPP2R1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5519 (PPP2R1B)
SSDB
Motif
Pfam: HEAT PPP2R1A-like_HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N Htt_N-HEAT_1 PDS5 SCD M11L CLASP_N
Other DBs
NCBI-GeneID: 5519
NCBI-ProteinID: NP_002707
OMIM: 603113
HGNC: 9303
Ensembl: ENSG00000137713
UniProt: P30154
LinkDB
Position
11:complement(111688000..111766389)
AA seq 601 aa
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgcatcagagctcgggaccggcccaggagcagcgggtggagatggagatgat
tcgctatacccgatcgcggttttaatcgacgagctccgcaatgaagacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgccctagcacttggagtagaaaggacccga
agtgaattgttgccatttcttacagatacaatttatgatgaagatgaggtactattagct
cttgctgagcagctgggaaatttcactggcctagtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaaatctggcaactgtggaagagactgttgttcgtgacaaggct
gtggagtccctgagacagatctcccaggagcatactcctgttgctctggaagcttatttt
gtacctctggtgaaacgcttagcaagtggggattggttcacctctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcatcaaatgctgttaaagcagaaatcagacag
caattccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccactg
ttcactagtctagcttcagatgaacaggattcagtgcgcctccttgctgtggaagcttgt
gtcagtattgcccagttattgtctcaggatgaccttgagactttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgcgttcgctatatggtggctgacagattttca
gagctccagaaagccatgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgggcagctgctgcccacaaagtaaaagaa
cttggtgagaacttgcccattgaagatagagagaccataattatgaatcaaattctgcct
tatataaaggaattagtatccgataccaatcaacatgtcaaatcggctctagcttctgta
attatgggattgtctactattttgggcaaagaaaataccattgaacatcttctacctctt
ttcttagctcagttaaaggatgagtgtcctgacgttcgtttgaatatcatctccaatttg
gattgtgtaaatgaagtgattggaatccgtcagctctctcagtctctccttcctgccata
gtggagctggcagaagatgccaaatggagggtccgcctggccatcattgagtatatgccg
ctgctggcaggccagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcttggctcgtggaccatgtatacgccatccgagaagctgccaccaacaacctcatgaaa
ctagttcagaagtttggtacagagtgggcccaaaatactattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttattctgcattaatgcactg
tctgaggcctgtggtcaggaaataactactaagcaaatgctgcccatcgtattaaaaatg
gcaggagaccaagtagcaaatgttcgcttcaatgtggccaaatctctacaaaagattgga
ccaattctagataccaatgctttacagggagaagtgaagccagtactacagaagttaggt
caagatgaagacatggatgtcaaatactttgcacaggaagctataagtgttcttgcattg
gcataa

DBGET integrated database retrieval system