KEGG   Homo sapiens (human): 6775
Entry
6775              CDS       T01001                                 

Gene name
STAT4, SLEB11
Definition
(RefSeq) signal transducer and activator of transcription 4
  KO
K11222  signal transducer and activator of transcription 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04630  JAK-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H01492  Systemic sclerosis
H01502  Sjogren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    6775 (STAT4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6775 (STAT4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    6775 (STAT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6775 (STAT4)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6775 (STAT4)
  09163 Immune disease
   05321 Inflammatory bowel disease
    6775 (STAT4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6775 (STAT4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    6775 (STAT4)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind SH2 CRC_subunit NPV_P10
Other DBs
NCBI-GeneID: 6775
NCBI-ProteinID: NP_001230764
OMIM: 600558
HGNC: 11365
Ensembl: ENSG00000138378
Vega: OTTHUMG00000132700
Pharos: Q14765(Tbio)
UniProt: Q14765
LinkDB
Position
2q32.2-q32.3
AA seq 748 aa
MSQWNQVQQLEIKFLEQVDQFYDDNFPMEIRHLLAQWIENQDWEAASNNETMATILLQNL
LIQLDEQLGRVSKEKNLLLIHNLKRIRKVLQGKFHGNPMHVAVVISNCLREERRILAAAN
MPVQGPLEKSLQSSSVSERQRNVEHKVAAIKNSVQMTEQDTKYLEDLQDEFDYRYKTIQT
MDQSDKNSAMVNQEVLTLQEMLNSLDFKRKEALSKMTQIIHETDLLMNTMLIEELQDWKR
RQQIACIGGPLHNGLDQLQNCFTLLAESLFQLRRQLEKLEEQSTKMTYEGDPIPMQRTHM
LERVTFLIYNLFKNSFVVERQPCMPTHPQRPLVLKTLIQFTVKLRLLIKLPELNYQVKVK
ASIDKNVSTLSNRRFVLCGTNVKAMSIEESSNGSLSVEFRHLQPKEMKSSAGGKGNEGCH
MVTEELHSITFETQICLYGLTIDLETSSLPVVMISNVSQLPNAWASIIWYNVSTNDSQNL
VFFNNPPPATLSQLLEVMSWQFSSYVGRGLNSDQLHMLAEKLTVQSSYSDGHLTWAKFCK
EHLPGKSFTFWTWLEAILDLIKKHILPLWIDGYVMGFVSKEKERLLLKDKMPGTFLLRFS
ESHLGGITFTWVDHSESGEVRFHSVEPYNKGRLSALPFADILRDYKVIMAENIPENPLKY
LYPDIPKDKAFGKHYSSQPCEVSRPTERGDKGYVPSVFIPISTIRSDSTEPHSPSDLLPM
SPSVYAVLRENLSPTTIETAMKSPYSAE
NT seq 2247 nt   +upstreamnt  +downstreamnt
atgtctcagtggaatcaagtccaacagttagaaatcaagtttttggagcaggtggatcaa
ttctatgatgacaactttcccatggaaattcggcatctgttggcccaatggattgaaaat
caagactgggaggcagcttctaacaatgaaaccatggcaacgattcttcttcaaaacttg
ttaatacaactggatgaacagttaggtcgtgtttccaaagagaaaaacctactcttgata
cacaatctaaaaagaattaggaaggtccttcagggaaaatttcatggaaatccaatgcat
gtagctgtggttatttcaaactgtttaagggaagagaggagaatattggctgcagccaac
atgcctgtccaggggcctctagagaaatccttacaaagttcttcagtttcagaaagacag
aggaatgtggagcacaaagtggctgccattaaaaacagtgtgcagatgacagaacaagat
accaaatacttagaagatctgcaagacgaatttgactacaggtataaaacaattcagaca
atggatcagagtgacaagaatagtgccatggtgaatcaggaagttttgacactgcaggaa
atgcttaacagcctcgatttcaagagaaaggaggctctcagtaaaatgacccaaatcatc
catgagacagacctgttaatgaacaccatgctcatagaagagctgcaagactggaagcgg
cggcagcaaatcgcctgcatcgggggtccactccacaatgggctcgaccagcttcagaac
tgctttacactattggcagaaagtcttttccaactgagaaggcaattggagaaactagag
gagcaatctaccaaaatgacatatgaaggtgatcccattccaatgcaaagaactcacatg
ctagaaagagtcaccttcttgatctacaaccttttcaagaactcatttgtggttgagcga
cagccatgtatgccaacccaccctcagaggccgttggtacttaaaaccctaattcagttc
actgtaaaactaaggctactaataaaattgccagaactaaactatcaggtaaaggttaag
gcatcaattgacaagaatgtttcaactctaagcaaccgaagatttgtactttgtggaact
aatgtcaaagccatgtctattgaagaatcttccaatgggagtctctcagtagaatttcga
catttgcaaccaaaggaaatgaagtccagtgctggaggtaaaggaaatgagggctgtcac
atggtgactgaagaacttcattccataacgtttgaaacacagatctgcctctatggcctg
accatagatttggagaccagctcattgcctgtggtgatgatttccaatgtcagtcagtta
cctaatgcttgggcatccatcatttggtacaacgtgtcaaccaacgattcccagaacttg
gttttctttaataatcctccacctgccacattgagtcaactactggaggtgatgagctgg
cagttttcatcgtacgttggtcgtggtcttaactcagatcaactccatatgctggcagag
aagcttacagtccaatctagctacagtgatggtcacctcacctgggccaagttctgcaag
gaacatttacctggtaaatcatttaccttttggacatggcttgaagcaatattggatcta
attaagaaacacattcttcccctttggattgatgggtatgtcatgggctttgttagcaaa
gagaaggaacggctgttgctaaaggataaaatgcctggcacctttttattaagattcagt
gaaagccatctcggaggaataactttcacctgggtggaccattctgaaagtggggaagtg
agattccactctgtagaaccctacaataaaggccggttgtctgctctgccattcgctgac
atcctgcgagactacaaagttattatggctgaaaacattcctgaaaaccctctgaagtac
ctatatcctgacattcccaaagacaaagccttcggtaaacactacagctctcagccttgc
gaagtttcaagaccaacagaaaggggtgacaaaggttatgttccttctgtttttatcccc
atctcaacaatccgaagtgattcaacagagccacattctccatcagaccttcttcccatg
tctccaagtgtgtatgcggtgttgagagaaaacctgagtcccacaacaattgaaactgca
atgaagtctccttattctgctgaatga

DBGET integrated database retrieval system