KEGG   Homo sapiens (human): 7097
Entry
7097              CDS       T01001                                 

Gene name
TLR2, CD282, TIL4
Definition
(RefSeq) toll like receptor 2
  KO
K10159  toll-like receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04151  PI3K-Akt signaling pathway
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa05132  Salmonella infection
hsa05134  Legionellosis
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05205  Proteoglycans in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05323  Rheumatoid arthritis
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06263  Hepatocellular carcinoma
  Element
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00556  HBV HBe to TLR2/4-NFKB signaling pathway
Disease
H00344  Leprosy
H01358  Atopic dermatitis
Drug target
Tomaralimab: D11503
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7097 (TLR2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    7097 (TLR2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    7097 (TLR2)
   04620 Toll-like receptor signaling pathway
    7097 (TLR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    7097 (TLR2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    7097 (TLR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    7097 (TLR2)
   05161 Hepatitis B
    7097 (TLR2)
   05171 Coronavirus disease - COVID-19
    7097 (TLR2)
   05162 Measles
    7097 (TLR2)
   05168 Herpes simplex virus 1 infection
    7097 (TLR2)
   05169 Epstein-Barr virus infection
    7097 (TLR2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    7097 (TLR2)
   05134 Legionellosis
    7097 (TLR2)
   05152 Tuberculosis
    7097 (TLR2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7097 (TLR2)
   05144 Malaria
    7097 (TLR2)
   05145 Toxoplasmosis
    7097 (TLR2)
   05140 Leishmaniasis
    7097 (TLR2)
   05142 Chagas disease
    7097 (TLR2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7097 (TLR2)
   05321 Inflammatory bowel disease
    7097 (TLR2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    7097 (TLR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7097 (TLR2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7097 (TLR2)
   04054 Pattern recognition receptors [BR:hsa04054]
    7097 (TLR2)
   04090 CD molecules [BR:hsa04090]
    7097 (TLR2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7097 (TLR2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    7097 (TLR2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7097 (TLR2)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   7097 (TLR2)
CD molecules [BR:hsa04090]
 Proteins
  7097 (TLR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   7097 (TLR2)
SSDB
Motif
Pfam: LRR_8 TIR LRR_4 TIR_2 LRR_9 LRR_5 LRR_1 LRRCT
Other DBs
NCBI-GeneID: 7097
NCBI-ProteinID: NP_001305716
OMIM: 603028
HGNC: 11848
Ensembl: ENSG00000137462
Vega: OTTHUMG00000161525
Pharos: O60603(Tchem)
UniProt: O60603 A0A0S2Z4S4 B3KWR9
LinkDB
Structure
PDB: 
1FYX 1FYW 1O77

Position
4q31.3
AA seq 784 aa
MPHTLWMVWVLGVIISLSKEESSNQASLSCDRNGICKGSSGSLNSIPSGLTEAVKSLDLS
NNRITYISNSDLQRCVNLQALVLTSNGINTIEEDSFSSLGSLEHLDLSYNYLSNLSSSWF
KPLSSLTFLNLLGNPYKTLGETSLFSHLTKLQILRVGNMDTFTKIQRKDFAGLTFLEELE
IDASDLQSYEPKSLKSIQNVSHLILHMKQHILLLEIFVDVTSSVECLELRDTDLDTFHFS
ELSTGETNSLIKKFTFRNVKITDESLFQVMKLLNQISGLLELEFDDCTLNGVGNFRASDN
DRVIDPGKVETLTIRRLHIPRFYLFYDLSTLYSLTERVKRITVENSKVFLVPCLLSQHLK
SLEYLDLSENLMVEEYLKNSACEDAWPSLQTLILRQNHLASLEKTGETLLTLKNLTNIDI
SKNSFHSMPETCQWPEKMKYLNLSSTRIHSVTGCIPKTLEILDVSNNNLNLFSLNLPQLK
ELYISRNKLMTLPDASLLPMLLVLKISRNAITTFSKEQLDSFHTLKTLEAGGNNFICSCE
FLSFTQEQQALAKVLIDWPANYLCDSPSHVRGQQVQDVRLSVSECHRTALVSGMCCALFL
LILLTGVLCHRFHGLWYMKMMWAWLQAKRKPRKAPSRNICYDAFVSYSERDAYWVENLMV
QELENFNPPFKLCLHKRDFIPGKWIIDNIIDSIEKSHKTVFVLSENFVKSEWCKYELDFS
HFRLFDENNDAAILILLEPIEKKAIPQRFCKLRKIMNTKTYLEWPMDEAQREGFWVNLRA
AIKS
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgccacatactttgtggatggtgtgggtcttgggggtcatcatcagcctctccaaggaa
gaatcctccaatcaggcttctctgtcttgtgaccgcaatggtatctgcaagggcagctca
ggatctttaaactccattccctcagggctcacagaagctgtaaaaagccttgacctgtcc
aacaacaggatcacctacattagcaacagtgacctacagaggtgtgtgaacctccaggct
ctggtgctgacatccaatggaattaacacaatagaggaagattctttttcttccctgggc
agtcttgaacatttagacttatcctataattacttatctaatttatcgtcttcctggttc
aagcccctttcttctttaacattcttaaacttactgggaaatccttacaaaaccctaggg
gaaacatctcttttttctcatctcacaaaattgcaaatcctgagagtgggaaatatggac
accttcactaagattcaaagaaaagattttgctggacttaccttccttgaggaacttgag
attgatgcttcagatctacagagctatgagccaaaaagtttgaagtcaattcagaatgta
agtcatctgatccttcatatgaagcagcatattttactgctggagatttttgtagatgtt
acaagttccgtggaatgtttggaactgcgagatactgatttggacactttccatttttca
gaactatccactggtgaaacaaattcattgattaaaaagtttacatttagaaatgtgaaa
atcaccgatgaaagtttgtttcaggttatgaaacttttgaatcagatttctggattgtta
gaattagagtttgatgactgtacccttaatggagttggtaattttagagcatctgataat
gacagagttatagatccaggtaaagtggaaacgttaacaatccggaggctgcatattcca
aggttttacttattttatgatctgagcactttatattcacttacagaaagagttaaaaga
atcacagtagaaaacagtaaagtttttctggttccttgtttactttcacaacatttaaaa
tcattagaatacttggatctcagtgaaaatttgatggttgaagaatacttgaaaaattca
gcctgtgaggatgcctggccctctctacaaactttaattttaaggcaaaatcatttggca
tcattggaaaaaaccggagagactttgctcactctgaaaaacttgactaacattgatatc
agtaagaatagttttcattctatgcctgaaacttgtcagtggccagaaaagatgaaatat
ttgaacttatccagcacacgaatacacagtgtaacaggctgcattcccaagacactggaa
attttagatgttagcaacaacaatctcaatttattttctttgaatttgccgcaactcaaa
gaactttatatttccagaaataagttgatgactctaccagatgcctccctcttacccatg
ttactagtattgaaaatcagtaggaatgcaataactacgttttctaaggagcaacttgac
tcatttcacacactgaagactttggaagctggtggcaataacttcatttgctcctgtgaa
ttcctctccttcactcaggagcagcaagcactggccaaagtcttgattgattggccagca
aattacctgtgtgactctccatcccatgtgcgtggccagcaggttcaggatgtccgcctc
tcggtgtcggaatgtcacaggacagcactggtgtctggcatgtgctgtgctctgttcctg
ctgatcctgctcacgggggtcctgtgccaccgtttccatggcctgtggtatatgaaaatg
atgtgggcctggctccaggccaaaaggaagcccaggaaagctcccagcaggaacatctgc
tatgatgcatttgtttcttacagtgagcgggatgcctactgggtggagaaccttatggtc
caggagctggagaacttcaatccccccttcaagttgtgtcttcataagcgggacttcatt
cctggcaagtggatcattgacaatatcattgactccattgaaaagagccacaaaactgtc
tttgtgctttctgaaaactttgtgaagagtgagtggtgcaagtatgaactggacttctcc
catttccgtctttttgatgagaacaatgatgctgccattctcattcttctggagcccatt
gagaaaaaagccattccccagcgcttctgcaagctgcggaagataatgaacaccaagacc
tacctggagtggcccatggacgaggctcagcgggaaggattttgggtaaatctgagagct
gcgataaagtcctag

DBGET integrated database retrieval system