KEGG   Homo sapiens (human): 715
Entry
715               CDS       T01001                                 

Symbol
C1R, EDSPD1
Name
(RefSeq) complement C1r
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    715 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    715 (C1R)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    715 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    715 (C1R)
   05150 Staphylococcus aureus infection
    715 (C1R)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    715 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    715 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    715 (C1R)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     715 (C1R)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   715 (C1R)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    715 (C1R)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF Trypsin_2
Other DBs
NCBI-GeneID: 715
NCBI-ProteinID: NP_001724
OMIM: 613785
HGNC: 1246
Ensembl: ENSG00000159403
Vega: OTTHUMG00000168149
Pharos: P00736(Tclin)
UniProt: P00736
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 705 aa
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgtggctcttgtacctcctggtgccggccctgttctgcagggcaggaggctccattccc
atccctcagaagttatttggggaggtgacttcccctctgttccccaagccttaccccaac
aactttgaaacaaccactgtgatcacagtccccacgggatacagggtgaagctcgtcttc
cagcagtttgacctggagccttctgaaggctgcttctatgattatgtcaagatctctgct
gataagaaaagcctggggaggttctgtgggcaactgggttctccactgggcaaccccccg
ggaaagaaggaatttatgtcccaagggaacaagatgctgctgaccttccacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaagct
gtggaccttgatgaatgtgcttcccggagcaaatcaggggaggaggatccccagccccag
tgccagcacctgtgtcacaactacgttggaggctacttctgttcctgccgtccaggctat
gagcttcaggaagacaggcattcctgccaggctgagtgcagcagcgagctgtacacggag
gcatcaggctacatctccagcctggagtaccctcggtcctacccccctgacctgcgctgc
aactacagcatccgggtggagcggggcctcaccctgcacctcaagttcctggagcctttt
gatattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccaac
gggaagaacattggcgagttctgtgggaagcaaaggccccccgacctcgacaccagcagc
aatgctgtggatctgctgttcttcacagatgagtcgggggacagccggggctggaagctg
cgctacaccaccgagatcatcaagtgcccccagcccaagaccctagacgagttcaccatc
atccagaacctgcagcctcagtaccagttccgtgactacttcattgctacctgcaagcaa
ggctaccagctcatagaggggaaccaggtgctgcattccttcacagctgtctgccaggat
gatggcacgtggcatcgtgccatgcccagatgcaagatcaaggactgtgggcagccccga
aacctgcctaatggtgacttccgttacaccaccacaatgggagtgaacacctacaaggcc
cgtatccagtactactgccatgagccatattacaagatgcagaccagagctggcagcagg
gagtctgagcaaggggtgtacacctgcacagcacagggcatttggaagaatgaacagaag
ggagagaagattcctcggtgcttgccagtgtgtgggaagcccgtgaaccccgtggaacag
aggcagcgcatcatcggagggcaaaaagccaagatgggcaacttcccctggcaggtgttc
accaacatccacgggcgcgggggcggggccctgctgggcgaccgctggatcctcacagct
gcccacaccctgtatcccaaggaacacgaagcgcaaagcaacgcctctttggatgtgttc
ctgggccacacaaatgtggaagagctcatgaagctaggaaatcaccccatccgcagggtc
agcgtccacccggactaccgtcaggatgagtcctacaattttgagggggacatcgccctg
ctggagctggaaaatagtgtcaccctgggtcccaacctcctccccatctgcctccctgac
aacgataccttctacgacctgggcttgatgggctatgtcagtggcttcggggtcatggag
gagaagattgctcatgacctcaggtttgtccgtctgcccgtagctaatccacaggcctgt
gagaactggctccggggaaagaataggatggatgtgttctctcaaaacatgttctgtgct
ggacacccatctctaaagcaggacgcctgccagggggatagtgggggcgtttttgcagta
agggacccgaacactgatcgctgggtggccacgggcatcgtgtcctggggcatcgggtgc
agcaggggctatggcttctacaccaaagtgctcaactacgtggactggatcaagaaagag
atggaggaggaggactga

DBGET integrated database retrieval system