KEGG   Homo sapiens (human): 7471
Entry
7471              CDS       T01001                                 

Symbol
WNT1, BMND16, INT1, OI15
Name
(RefSeq) Wnt family member 1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06217  HH signaling
nt06227  Nuclear receptor signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06269  Basal cell carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
Disease
H00506  Osteogenesis imperfecta
H01593  Osteoporosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7471 (WNT1)
   04390 Hippo signaling pathway
    7471 (WNT1)
   04150 mTOR signaling pathway
    7471 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7471 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7471 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7471 (WNT1)
   05205 Proteoglycans in cancer
    7471 (WNT1)
   05207 Chemical carcinogenesis - receptor activation
    7471 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    7471 (WNT1)
   05226 Gastric cancer
    7471 (WNT1)
   05217 Basal cell carcinoma
    7471 (WNT1)
   05224 Breast cancer
    7471 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7471 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7471 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    7471 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    7471 (WNT1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7471 (WNT1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Morphogens
   7471 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 7471
NCBI-ProteinID: NP_005421
OMIM: 164820
HGNC: 12774
Ensembl: ENSG00000125084
Vega: OTTHUMG00000170403
Pharos: P04628(Tbio)
UniProt: P04628
LinkDB
Position
12q13.12
AA seq 370 aa
MGLWALLPGWVSATLLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTAPGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggctctgggcgctgttgcctggctgggtttctgctacgctgctgctggcgctggcc
gctctgcccgcagccctggctgccaacagcagtggccgatggtggggtattgtgaacgta
gcctcctccacgaacctgcttacagactccaagagtctgcaactggtactcgagcccagt
ctgcagctgttgagccgcaaacagcggcgtctgatacgccaaaatccggggatcctgcac
agcgtgagtggggggctgcagagtgccgtgcgcgagtgcaagtggcagttccggaatcgc
cgctggaactgtcccactgctccagggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgagaaacggcgtttatcttcgctatcacctccgccggggtcacccattcggtggcg
cgctcctgctcagaaggttccatcgaatcctgcacgtgtgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacattgacttcggccgcctcttc
ggccgggagttcgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctt
cacaacaacgaggcaggccgtacgaccgtattctccgagatgcgccaggagtgcaagtgc
cacgggatgtccggctcatgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgatgtgctgcgcgaccgcttcgacggcgcctcgcgcgtcctgtacggcaac
cgcggcagcaaccgcgcttcgcgggcggagctgctgcgcctggagccggaagacccggcc
cacaaaccgccctccccccacgacctcgtctacttcgagaaatcgcccaacttctgcacg
tacagcggacgcctgggcacagcaggcacggcagggcgcgcctgtaacagctcgtcgccc
gcgctggacggctgcgagctgctctgctgcggcaggggccaccgcacgcgcacgcagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Homo sapiens (human): 4853
Entry
4853              CDS       T01001                                 

Symbol
NOTCH2, AGS2, HJCYS, hN2
Name
(RefSeq) notch receptor 2
  KO
K20994  Notch 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
Disease
H00409  Type 2 diabetes mellitus
H00551  Alagille syndrome
H00623  Hajdu-Cheney syndrome
Drug target
Tarextumab: D11775
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4853 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    4853 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4853 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4853 (NOTCH2)
   05206 MicroRNAs in cancer
    4853 (NOTCH2)
   05207 Chemical carcinogenesis - receptor activation
    4853 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    4853 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4853 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    4853 (NOTCH2)
SSDB
Motif
Pfam: EGF hEGF EGF_CA DUF3454 NOD Notch EGF_2 Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Other DBs
NCBI-GeneID: 4853
NCBI-ProteinID: NP_077719
OMIM: 600275
HGNC: 7882
Ensembl: ENSG00000134250
Vega: OTTHUMG00000012177
Pharos: Q04721(Tchem)
UniProt: Q04721 Q9UFD5 Q6IQ50
LinkDB
Structure
PDB: 
5MWB 2OO4

Position
1p12
AA seq 2471 aa
MPALRPALLWALLALWLCCAAPAHALQCRDGYEPCVNEGMCVTYHNGTGYCKCPEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGT
CHMLSRDTYECTCQVGFTGKECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCE
TDVNECDIPGHCQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCIHGICM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKESPNFESYTCLCAPGWQGQRCTIDIDECISKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGINSFSCLCPVGFTGS
FCLHEINECSSHPCLNEGTCVDGLGTYRCSCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
KKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLG
YTGSYCEEQLDECASNPCQHGATCSDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDDCARGPHCLNGGQCMDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRKGEQCVHTASGPRCFCPSPRDCESGCAS
SPCQHGGSCHPQRQPPYYSCQCAPPFSGSRCELYTAPPSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTVECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADQPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLHTNLRIKRDSQGELMVYPYYGEKSAAMKKQRMTRRSLPGEQEQEVAG
SKVFLEIDNRQCVQDSDHCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTPERTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDASNHKRREPVGQDAVGLKNL
SVQVSEANLIGTGTSEHWVDDEGPQPKKVKAEDEALLSEEDDPIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKSRRPSAKSTMPTSLPNLAKEAKDAKGSRRKKSLSEKVQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGASTVLPS
VSQLLSHHHIVSPGSGSAGSLSRLHPVPVPADWMNRMEVNETQYNEMFGMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSIAQPAGAPQPQSTCPPAVAGPLPTMY
QIPEMARLPSVAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPHNNMQVYA
NT seq 7416 nt   +upstreamnt  +downstreamnt
atgcccgccctgcgccccgctctgctgtgggcgctgctggcgctctggctgtgctgcgcg
gcccccgcgcatgcattgcagtgtcgagatggctatgaaccctgtgtaaatgaaggaatg
tgtgttacctaccacaatggcacaggatactgcaaatgtccagaaggcttcttgggggaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggtgggacttgtgtg
gcccaggccatgctggggaaagccacgtgccgatgtgcctcagggtttacaggagaggac
tgccagtactcaacatctcatccatgctttgtgtctcgaccctgcctgaatggcggcaca
tgccatatgctcagccgggatacctatgagtgcacctgtcaagtcgggtttacaggtaag
gagtgccaatggacggatgcctgcctgtctcatccctgtgcaaatggaagtacctgtacc
actgtggccaaccagttctcctgcaaatgcctcacaggcttcacagggcagaaatgtgag
actgatgtcaatgagtgtgacattccaggacactgccagcatggtggcacctgcctcaac
ctgcctggttcctaccagtgccagtgccctcagggcttcacaggccagtactgtgacagc
ctgtatgtgccctgtgcaccctcaccttgtgtcaatggaggcacctgtcggcagactggt
gacttcacttttgagtgcaactgccttccaggttttgaagggagcacctgtgagaggaat
attgatgactgccctaaccacaggtgtcagaatggaggggtttgtgtggatggggtcaac
acttacaactgccgctgtcccccacaatggacaggacagttctgcacagaggatgtggat
gaatgcctgctgcagcccaatgcctgtcaaaatgggggcacctgtgccaaccgcaatgga
ggctatggctgtgtatgtgtcaacggctggagtggagatgactgcagtgagaacattgat
gattgtgccttcgcctcctgtactccaggctccacctgcatcgaccgtgtggcctccttc
tcttgcatgtgcccagaggggaaggcaggtctcctgtgtcatctggatgatgcatgcatc
agcaatccttgccacaagggggcactgtgtgacaccaaccccctaaatgggcaatatatt
tgcacctgcccacaaggctacaaaggggctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaacacggatggcgccttc
cactgtgagtgtctgaagggttatgcaggacctcgttgtgagatggacatcaatgagtgc
cattcagacccctgccagaatgatgctacctgtctggataagattggaggcttcacatgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattagaaataaatgaatgtcagagc
aacccttgtgtgaacaatgggcagtgtgtggataaagtcaatcgtttccagtgcctgtgt
cctcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtatcgatcacccgaatggctatgaatgccagtgtgccaca
ggtttcactggtgtgttgtgtgaggagaacattgacaactgtgaccccgatccttgccac
catggtcagtgtcaggatggtattgattcctacacctgcatctgcaatcccgggtacatg
ggcgccatctgcagtgaccagattgatgaatgttacagcagcccttgcctgaacgatggt
cgctgcattgacctggtcaatggctaccagtgcaactgccagccaggcacgtcaggggtt
aattgtgaaattaattttgatgactgtgcaagtaacccttgtatccatggaatctgtatg
gatggcattaatcgctacagttgtgtctgctcaccaggattcacagggcagagatgtaac
attgacattgatgagtgtgcctccaatccctgtcgcaagggtgcaacatgtatcaacggt
gtgaatggtttccgctgtatatgccccgagggaccccatcaccccagctgctactcacag
gtgaacgaatgcctgagcaatccctgcatccatggaaactgtactggaggtctcagtgga
tataagtgtctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgcctttcgaatccatgccagaatggaggaacttgtgacaatctggtgaatggatacagg
tgtacttgcaagaagggctttaaaggctataactgccaggtgaatattgatgaatgtgcc
tcaaatccatgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagacagtattggctccctgttccccaaac
ccttgtgagaatgctgctgtttgcaaagagtcaccaaattttgagagttatacttgcttg
tgtgctcctggctggcaaggtcagcggtgtaccattgacattgacgagtgtatctccaag
ccctgcatgaaccatggtctctgccataacacccagggcagctacatgtgtgaatgtcca
ccaggcttcagtggtatggactgtgaggaggacattgatgactgccttgccaatccttgc
cagaatggaggttcctgtatggatggagtgaatactttctcctgcctctgccttccgggt
ttcactggggataagtgccagacagacatgaatgagtgtctgagtgaaccctgtaagaat
ggagggacctgctctgactacgtcaacagttacacttgcaagtgccaggcaggatttgat
ggagtccattgtgagaacaacatcaatgagtgcactgagagctcctgtttcaatggtggc
acatgtgttgatgggattaactccttctcttgcttgtgccctgtgggtttcactggatcc
ttctgcctccatgagatcaatgaatgcagctctcatccatgcctgaatgagggaacgtgt
gttgatggcctgggtacctaccgctgcagctgccccctgggctacactgggaaaaactgt
cagaccctggtgaatctctgcagtcggtctccatgtaaaaacaaaggtacttgcgttcag
aaaaaagcagagtcccagtgcctatgtccatctggatgggctggtgcctattgtgacgtg
cccaatgtctcttgtgacatagcagcctccaggagaggtgtgcttgttgaacacttgtgc
cagcactcaggtgtctgcatcaatgctggcaacacgcattactgtcagtgccccctgggc
tatactgggagctactgtgaggagcaactcgatgagtgtgcgtccaacccctgccagcac
ggggcaacatgcagtgacttcattggtggatacagatgcgagtgtgtcccaggctatcag
ggtgtcaactgtgagtatgaagtggatgagtgccagaatcagccctgccagaatggaggc
acctgtattgaccttgtgaaccatttcaagtgctcttgcccaccaggcactcggggccta
ctctgtgaagagaacattgatgactgtgcccggggtccccattgccttaatggtggtcag
tgcatggataggattggaggctacagttgtcgctgcttgcctggctttgctggggagcgt
tgtgagggagacatcaacgagtgcctctccaacccctgcagctctgagggcagcctggac
tgtatacagctcaccaatgactacctgtgtgtttgccgtagtgcctttactggccggcac
tgtgaaaccttcgtcgatgtgtgtccccagatgccctgcctgaatggagggacttgtgct
gtggccagtaacatgcctgatggtttcatttgccgttgtcccccgggattttccggggca
aggtgccagagcagctgtggacaagtgaaatgtaggaagggggagcagtgtgtgcacacc
gcctctggaccccgctgcttctgccccagtccccgggactgcgagtcaggctgtgccagt
agcccctgccagcacgggggcagctgccaccctcagcgccagcctccttattactcctgc
cagtgtgccccaccattctcgggtagccgctgtgaactctacacggcaccccccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggatggcgtctgtgat
gaggcctgcaacagccatgcctgccagtgggatgggggtgactgttctctcaccatggag
aacccctgggccaactgctcctccccacttccctgctgggattatatcaacaaccagtgt
gatgagctgtgcaacacggtcgagtgcctgtttgacaactttgaatgccaggggaacagc
aagacatgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
gggtgcaacagtgaggagtgtggttgggatgggctggactgtgctgctgaccaacctgag
aacctggcagaaggtaccctggttattgtggtattgatgccacctgaacaactgctccag
gatgctcgcagcttcttgcgggcactgggtaccctgctccacaccaacctgcgcattaag
cgggactcccagggggaactcatggtgtacccctattatggtgagaagtcagctgctatg
aagaaacagaggatgacacgcagatcccttcctggtgaacaagaacaggaggtggctggc
tctaaagtctttctggaaattgacaaccgccagtgtgttcaagactcagaccactgcttc
aagaacacggatgcagcagcagctctcctggcctctcacgccatacaggggaccctgtca
taccctcttgtgtctgtcgtcagtgaatccctgactccagaacgcactcagctcctctat
ctccttgctgttgctgttgtcatcattctgtttattattctgctgggggtaatcatggca
aaacgaaagcgtaagcatggctctctctggctgcctgaaggtttcactcttcgccgagat
gcaagcaatcacaagcgtcgtgagccagtgggacaggatgctgtggggctgaaaaatctc
tcagtgcaagtctcagaagctaacctaattggtactggaacaagtgaacactgggtcgat
gatgaagggccccagccaaagaaagtaaaggctgaagatgaggccttactctcagaagaa
gatgaccccattgatcgacggccatggacacagcagcaccttgaagctgcagacatccgt
aggacaccatcgctggctctcacccctcctcaggcagagcaggaggtggatgtgttagat
gtgaatgtccgtggcccagatggctgcaccccattgatgttggcttctctccgaggaggc
agctcagatttgagtgatgaagatgaagatgcagaggactcttctgctaacatcatcaca
gacttggtctaccagggtgccagcctccaggcccagacagaccggactggtgagatggcc
ctgcaccttgcagcccgctactcacgggctgatgctgccaagcgtctcctggatgcaggt
gcagatgccaatgcccaggacaacatgggccgctgtccactccatgctgcagtggcagct
gatgcccaaggtgtcttccagattctgattcgcaaccgagtaactgatctagatgccagg
atgaatgatggtactacacccctgatcctggctgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcggatgtgaatgcagtggatgaccatggaaaatctgct
cttcactgggcagctgctgtcaataatgtggaggcaactcttttgttgttgaaaaatggg
gccaaccgagacatgcaggacaacaaggaagagacacctctgtttcttgctgcccgggag
gggagctatgaagcagccaagatcctgttagaccattttgccaatcgagacatcacagac
catatggatcgtcttccccgggatgtggctcgggatcgcatgcaccatgacattgtgcgc
cttctggatgaatacaatgtgaccccaagccctccaggcaccgtgttgacttctgctctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctgaagcacaccccaatgggc
aagaagtctagacggcccagtgccaagagtaccatgcctactagcctccctaaccttgcc
aaggaggcaaaggatgccaagggtagtaggaggaagaagtctctgagtgagaaggtccaa
ctgtctgagagttcagtaactttatcccctgttgattccctagaatctcctcacacgtat
gtttccgacaccacatcctctccaatgattacatcccctgggatcttacaggcctcaccc
aaccctatgttggccactgccgcccctcctgccccagtccatgcccagcatgcactatct
ttttctaaccttcatgaaatgcagcctttggcacatggggccagcactgtgcttccctca
gtgagccagttgctatcccaccaccacattgtgtctccaggcagtggcagtgctggaagc
ttgagtaggctccatccagtcccagtcccagcagattggatgaaccgcatggaggtgaat
gagacccagtacaatgagatgtttggtatggtcctggctccagctgagggcacccatcct
ggcatagctccccagagcaggccacctgaagggaagcacataaccacccctcgggagccc
ttgccccccattgtgactttccagctcatccctaaaggcagtattgcccaaccagcgggg
gctccccagcctcagtccacctgccctccagctgttgcgggccccctgcccaccatgtac
cagattccagaaatggcccgtttgcccagtgtggctttccccactgccatgatgccccag
caggacgggcaggtagctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggcaagtaccccacacccccttcacagcacagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggaggtcagcggggacctgggacacacatgtct
gagccaccacacaacaacatgcaggtttatgcgtga

KEGG   Homo sapiens (human): 182
Entry
182               CDS       T01001                                 

Symbol
JAG1, AGS, AGS1, AHD, AWS, CD339, DCHE, HJ1, JAGL1
Name
(RefSeq) jagged canonical Notch ligand 1
  KO
K06052  jagged-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04330  Notch signaling pathway
hsa04371  Apelin signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04668  TNF signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06465  Prion disease
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00380  HPV E6 to Notch signaling pathway
N01363  P4/MPA to nuclear-initiated progesterone signaling pathway
Disease
H00549  Tetralogy of Fallot
H00551  Alagille syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    182 (JAG1)
   04371 Apelin signaling pathway
    182 (JAG1)
   04668 TNF signaling pathway
    182 (JAG1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    182 (JAG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    182 (JAG1)
   05207 Chemical carcinogenesis - receptor activation
    182 (JAG1)
  09162 Cancer: specific types
   05224 Breast cancer
    182 (JAG1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    182 (JAG1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    182 (JAG1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    182 (JAG1)
CD molecules [BR:hsa04090]
 Proteins
  182 (JAG1)
SSDB
Motif
Pfam: EGF hEGF MNNL EGF_2 DSL EGF_CA cEGF EGF_3 DUF2920
Other DBs
NCBI-GeneID: 182
NCBI-ProteinID: NP_000205
OMIM: 601920
HGNC: 6188
Ensembl: ENSG00000101384
Vega: OTTHUMG00000031872
Pharos: P78504(Tbio)
UniProt: P78504 Q99740
LinkDB
Structure
PDB: 
4CC0 4CBZ 2VJ2 5BO1 4CC1

Position
20p12.2
AA seq 1218 aa
MRSPRTRGRSGRPLSLLLALLCALRAKVCGASGQFELEILSMQNVNGELQNGNCCGGARN
PGDRKCTRDECDTYFKVCLKEYQSRVTAGGPCSFGSGSTPVIGGNTFNLKASRGNDRNRI
VLPFSFAWPRSYTLLVEAWDSSNDTVQPDSIIEKASHSGMINPSRQWQTLKQNTGVAHFE
YQIRVTCDDYYYGFGCNKFCRPRDDFFGHYACDQNGNKTCMEGWMGPECNRAICRQGCSP
KHGSCKLPGDCRCQYGWQGLYCDKCIPHPGCVHGICNEPWQCLCETNWGGQLCDKDLNYC
GTHQPCLNGGTCSNTGPDKYQCSCPEGYSGPNCEIAEHACLSDPCHNRGSCKETSLGFEC
ECSPGWTGPTCSTNIDDCSPNNCSHGGTCQDLVNGFKCVCPPQWTGKTCQLDANECEAKP
CVNAKSCKNLIASYYCDCLPGWMGQNCDININDCLGQCQNDASCRDLVNGYRCICPPGYA
GDHCERDIDECASNPCLNGGHCQNEINRFQCLCPTGFSGNLCQLDIDYCEPNPCQNGAQC
YNRASDYFCKCPEDYEGKNCSHLKDHCRTTPCEVIDSCTVAMASNDTPEGVRYISSNVCG
PHGKCKSQSGGKFTCDCNKGFTGTYCHENINDCESNPCRNGGTCIDGVNSYKCICSDGWE
GAYCETNINDCSQNPCHNGGTCRDLVNDFYCDCKNGWKGKTCHSRDSQCDEATCNNGGTC
YDEGDAFKCMCPGGWEGTTCNIARNSSCLPNPCHNGGTCVVNGESFTCVCKEGWEGPICA
QNTNDCSPHPCYNSGTCVDGDNWYRCECAPGFAGPDCRININECQSSPCAFGATCVDEIN
GYRCVCPPGHSGAKCQEVSGRPCITMGSVIPDGAKWDDDCNTCQCLNGRIACSKVWCGPR
PCLLHKGHSECPSGQSCIPILDDQCFVHPCTGVGECRSSSLQPVKTKCTSDSYYQDNCAN
ITFTFNKEMMSPGLTTEHICSELRNLNILKNVSAEYSIYIACEPSPSANNEIHVAISAED
IRDDGNPIKEITDKIIDLVSKRDGNSSLIAAVAEVRVQRRPLKNRTDFLVPLLSSVLTVA
WICCLVTAFYWCLRKRRKPGSHTHSASEDNTTNNVREQLNQIKNPIEKHGANTVPIKDYE
NKNSKMSKIRTHNSEVEEDDMDKHQQKARFAKQPAYTLVDREEKPPNGTPTKHPNWTNKQ
DNRDLESAQSLNRMEYIV
NT seq 3657 nt   +upstreamnt  +downstreamnt
atgcgttccccacggacgcgcggccggtccgggcgccccctaagcctcctgctcgccctg
ctctgtgccctgcgagccaaggtgtgtggggcctcgggtcagttcgagttggagatcctg
tccatgcagaacgtgaacggggagctgcagaacgggaactgctgcggcggcgcccggaac
ccgggagaccgcaagtgcacccgcgacgagtgtgacacatacttcaaagtgtgcctcaag
gagtatcagtcccgcgtcacggccggggggccctgcagcttcggctcagggtccacgcct
gtcatcgggggcaacaccttcaacctcaaggccagccgcggcaacgaccgcaaccgcatc
gtgctgcctttcagtttcgcctggccgaggtcctatacgttgcttgtggaggcgtgggat
tccagtaatgacaccgttcaacctgacagtattattgaaaaggcttctcactcgggcatg
atcaaccccagccggcagtggcagacgctgaagcagaacacgggcgttgcccactttgag
tatcagatccgcgtgacctgtgatgactactactatggctttggctgcaataagttctgc
cgccccagagatgacttctttggacactatgcctgtgaccagaatggcaacaaaacttgc
atggaaggctggatgggccccgaatgtaacagagctatttgccgacaaggctgcagtcct
aagcatgggtcttgcaaactcccaggtgactgcaggtgccagtacggctggcaaggcctg
tactgtgataagtgcatcccacacccgggatgcgtccacggcatctgtaatgagccctgg
cagtgcctctgtgagaccaactggggcggccagctctgtgacaaagatctcaattactgt
gggactcatcagccgtgtctcaacgggggaacttgtagcaacacaggccctgacaaatat
cagtgttcctgccctgaggggtattcaggacccaactgtgaaattgctgagcacgcctgc
ctctctgatccctgtcacaacagaggcagctgtaaggagacctccctgggctttgagtgt
gagtgttccccaggctggaccggccccacatgctctacaaacattgatgactgttctcct
aataactgttcccacgggggcacctgccaggacctggttaacggatttaagtgtgtgtgc
cccccacagtggactgggaaaacgtgccagttagatgcaaatgaatgtgaggccaaacct
tgtgtaaacgccaaatcctgtaagaatctcattgccagctactactgcgactgtcttccc
ggctggatgggtcagaattgtgacataaatattaatgactgccttggccagtgtcagaat
gacgcctcctgtcgggatttggttaatggttatcgctgtatctgtccacctggctatgca
ggcgatcactgtgagagagacatcgatgaatgtgccagcaacccctgtttgaatgggggt
cactgtcagaatgaaatcaacagattccagtgtctgtgtcccactggtttctctggaaac
ctctgtcagctggacatcgattattgtgagcctaatccctgccagaacggtgcccagtgc
tacaaccgtgccagtgactatttctgcaagtgccccgaggactatgagggcaagaactgc
tcacacctgaaagaccactgccgcacgaccccctgtgaagtgattgacagctgcacagtg
gccatggcttccaacgacacacctgaaggggtgcggtatatttcctccaacgtctgtggt
cctcacgggaagtgcaagagtcagtcgggaggcaaattcacctgtgactgtaacaaaggc
ttcacgggaacatactgccatgaaaatattaatgactgtgagagcaacccttgtagaaac
ggtggcacttgcatcgatggtgtcaactcctacaagtgcatctgtagtgacggctgggag
ggggcctactgtgaaaccaatattaatgactgcagccagaacccctgccacaatgggggc
acgtgtcgcgacctggtcaatgacttctactgtgactgtaaaaatgggtggaaaggaaag
acctgccactcacgtgacagtcagtgtgatgaggccacgtgcaacaacggtggcacctgc
tatgatgagggggatgcttttaagtgcatgtgtcctggcggctgggaaggaacaacctgt
aacatagcccgaaacagtagctgcctgcccaacccctgccataatgggggcacatgtgtg
gtcaacggcgagtcctttacgtgcgtctgcaaggaaggctgggaggggcccatctgtgct
cagaataccaatgactgcagccctcatccctgttacaacagcggcacctgtgtggatgga
gacaactggtaccggtgcgaatgtgccccgggttttgctgggcccgactgcagaataaac
atcaatgaatgccagtcttcaccttgtgcctttggagcgacctgtgtggatgagatcaat
ggctaccggtgtgtctgccctccagggcacagtggtgccaagtgccaggaagtttcaggg
agaccttgcatcaccatggggagtgtgataccagatggggccaaatgggatgatgactgt
aatacctgccagtgcctgaatggacggatcgcctgctcaaaggtctggtgtggccctcga
ccttgcctgctccacaaagggcacagcgagtgccccagcgggcagagctgcatccccatc
ctggacgaccagtgcttcgtccacccctgcactggtgtgggcgagtgtcggtcttccagt
ctccagccggtgaagacaaagtgcacctctgactcctattaccaggataactgtgcgaac
atcacatttacctttaacaaggagatgatgtcaccaggtcttactacggagcacatttgc
agtgaattgaggaatttgaatattttgaagaatgtttccgctgaatattcaatctacatc
gcttgcgagccttccccttcagcgaacaatgaaatacatgtggccatttctgctgaagat
atacgggatgatgggaacccgatcaaggaaatcactgacaaaataatcgatcttgttagt
aaacgtgatggaaacagctcgctgattgctgccgttgcagaagtaagagttcagaggcgg
cctctgaagaacagaacagatttccttgttcccttgctgagctctgtcttaactgtggct
tggatctgttgcttggtgacggccttctactggtgcctgcggaagcggcggaagccgggc
agccacacacactcagcctctgaggacaacaccaccaacaacgtgcgggagcagctgaac
cagatcaaaaaccccattgagaaacatggggccaacacggtccccatcaaggattatgag
aacaagaactccaaaatgtctaaaataaggacacacaattctgaagtagaagaggacgac
atggacaaacaccagcagaaagcccggtttgccaagcagccggcgtacacgctggtagac
agagaagagaagccccccaacggcacgccgacaaaacacccaaactggacaaacaaacag
gacaacagagacttggaaagtgcccagagcttaaaccgaatggagtacatcgtatag

DBGET integrated database retrieval system