KEGG   Homo sapiens (human): 10013Help
Entry
10013             CDS       T01001                                 

Gene name
HDAC6, CPBHM, HD6, JM21, PPP1R90
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Disease
H02260  Chondrodysplasia Chassaing-Lacombe type
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Citarinostat: D10918
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Ricolinostat: D10661
Romidepsin: D06637
Tinostamustine: D11182
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    10013 (HDAC6)
  09165 Substance dependence
   05034 Alcoholism
    10013 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    10013 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    10013 (HDAC6)
   04131 Membrane trafficking [BR:hsa04131]
    10013 (HDAC6)
   03036 Chromosome and associated proteins [BR:hsa03036]
    10013 (HDAC6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10013 (HDAC6)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     10013 (HDAC6)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     10013 (HDAC6)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    10013 (HDAC6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10013 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 10013
NCBI-ProteinID: NP_001308155
OMIM: 300272
HGNC: 14064
Ensembl: ENSG00000094631
Vega: OTTHUMG00000034496
Pharos: Q9UBN7(Tclin)
UniProt: Q9UBN7 A0A024QZ26
LinkDB All DBs
Structure
PDB: 

Position
Xp11.23
AA seq 1215 aa AA seqDB search
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH
NT seq 3648 nt NT seq  +upstreamnt  +downstreamnt
atgacctcaaccggccaggattccaccacaaccaggcagcgaagaagtaggcagaacccc
cagtcgccccctcaggactccagtgtcacttcgaagcgaaatattaaaaagggagccgtt
ccccgctctatccccaatctagcggaggtaaagaagaaaggcaaaatgaagaagctcggc
caagcaatggaagaagacctaatcgtgggactgcaagggatggatctgaaccttgaggct
gaagcactggctggcactggcttggtgttggatgagcagttaaatgaattccattgcctc
tgggatgacagcttcccggaaggccctgagcggctccatgccatcaaggagcaactgatc
caggagggcctcctagatcgctgcgtgtcctttcaggcccggtttgctgaaaaggaagag
ctgatgttggttcacagcctagaatatattgatctgatggaaacaacccagtacatgaat
gagggagaactccgtgtcctagcagacacctacgactcagtttatctgcatccgaactca
tactcctgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcggtcctgggg
gctgagatccggaatggcatggccatcattaggcctcctggacatcacgcccagcacagt
cttatggatggctattgcatgttcaaccacgtggctgtggcagcccgctatgctcaacag
aaacaccgcatccggagggtccttatcgtagattgggatgtgcaccacggtcaaggaaca
cagttcaccttcgaccaggaccccagtgtcctctatttctccatccaccgctacgagcag
ggtaggttctggccccacctgaaggcctctaactggtccaccacaggtttcggccaaggc
caaggatataccatcaatgtgccttggaaccaggtggggatgcgggatgctgactacatt
gctgctttcctgcacgtcctgctgccagtcgccctcgagttccagcctcagctggtcctg
gtggctgctggatttgatgccctgcaaggggaccccaagggtgagatggccgccactccg
gcagggttcgcccagctaacccacctgctcatgggtctggcaggaggcaagctgatcctg
tctctggagggtggctacaacctccgcgccctggctgaaggcgtcagtgcttcgctccac
acccttctgggagacccttgccccatgctggagtcacctggtgccccctgccggagtgcc
caggcttcagtttcctgtgctctggaagcccttgagcccttctgggaggttcttgtgaga
tcaactgagaccgtggagagggacaacatggaggaggacaatgtagaggagagcgaggag
gaaggaccctgggagccccctgtgctcccaatcctgacatggccagtgctacagtctcgc
acagggctggtctatgaccaaaatatgatgaatcactgcaacttgtgggacagccaccac
cctgaggtaccccagcgcatcttgcggatcatgtgccgtctggaggagctgggccttgcc
gggcgctgcctcaccctgacaccgcgccctgccacagaggctgagctgctcacctgtcac
agtgctgagtacgtgggtcatctccgggccacagagaaaatgaaaacccgggagctgcac
cgtgagagttccaactttgactccatctatatctgccccagtaccttcgcctgtgcacag
cttgccactggcgctgcctgccgcctggtggaggctgtgctctcaggagaggttctgaat
ggtgctgctgtggtgcgtcccccaggacaccacgcagagcaggatgcagcttgcggtttt
tgctttttcaactctgtggctgtggctgctcgccatgcccagactatcagtgggcatgcc
ctacggatcctgattgtggattgggatgtccaccacggtaatggaactcagcacatgttt
gaggatgaccccagtgtgctatatgtgtccctgcaccgctatgatcatggcaccttcttc
cccatgggggatgagggtgccagcagccagatcggccgggctgcgggcacaggcttcacc
gtcaacgtggcatggaacgggccccgcatgggtgatgctgactacctagctgcctggcat
cgcctggtgcttcccattgcctacgagtttaacccagaactggtgctggtctcagctggc
tttgatgctgcacggggggatccgctggggggctgccaggtgtcacctgagggttatgcc
cacctcacccacctgctgatgggccttgccagtggccgcattatccttatcctagagggt
ggctataacctgacatccatctcagagtccatggctgcctgcactcgctccctccttgga
gacccaccacccctgctgaccctgccacggcccccactatcaggggccctggcctcaatc
actgagaccatccaagtccatcgcagatactggcgcagcttacgggtcatgaaggtagaa
gacagagaaggaccctccagttctaagttggtcaccaagaaggcaccccaaccagccaaa
cctaggttagctgagcggatgaccacacgagaaaagaaggttctggaagcaggcatgggg
aaagtcacctcggcatcatttggggaagagtccactccaggccagactaactcagagaca
gctgtggtggccctcactcaggaccagccctcagaggcagccacagggggagccactctg
gcccagaccatttctgaggcagccattgggggagccatgctgggccagaccacctcagag
gaggctgtcgggggagccactccggaccagaccacctcagaggagactgtgggaggagcc
attctggaccagaccacctcagaggatgctgttgggggagccacgctgggccagactacc
tcagaggaggctgtaggaggagctacactggcccagaccacctcggaggcagccatggag
ggagccacactggaccagactacgtcagaggaggctccagggggcaccgagctgatccaa
actcctctagcctcgagcacagaccaccagacccccccaacctcacctgtgcagggaact
acaccccagatatctcccagtacactgattgggagtctcaggaccttggagctaggcagc
gaatctcagggggcctcagaatctcaggccccaggagaggagaacctactaggagaggca
gctggaggtcaggacatggctgattcgatgctgatgcagggatctaggggcctcactgat
caggccatattttatgctgtgacaccactgccctggtgtccccatttggtggcagtatgc
cccatacctgcagcaggcctagacgtgacccaaccttgtggggactgtggaacaatccaa
gagaattgggtgtgtctctcttgctatcaggtctactgtggtcgttacatcaatggccac
atgctccaacaccatggaaattctggacacccgctggtcctcagctacatcgacctgtca
gcctggtgttactactgtcaggcctatgtccaccaccaggctctcctagatgtgaagaac
atcgcccaccagaacaagtttggggaggatatgccccacccacactaa

KEGG   Homo sapiens (human): 10014Help
Entry
10014             CDS       T01001                                 

Gene name
HDAC5, HD5, NY-CO-9
Definition
(RefSeq) histone deacetylase 5
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    10014 (HDAC5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    10014 (HDAC5)
   05203 Viral carcinogenesis
    10014 (HDAC5)
  09165 Substance dependence
   05034 Alcoholism
    10014 (HDAC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10014 (HDAC5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     10014 (HDAC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     10014 (HDAC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 10014
NCBI-ProteinID: NP_005465
OMIM: 605315
HGNC: 14068
Ensembl: ENSG00000108840
Vega: OTTHUMG00000181806
Pharos: Q9UQL6(Tclin)
UniProt: Q9UQL6
LinkDB All DBs
Position
17q21.31
AA seq 1122 aa AA seqDB search
MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
atgaactctcccaacgagtcggatgggatgtcaggtcgggaaccatccttggaaatcctg
ccgcggacttctctgcacagcatccctgtgacagtggaggtgaagccggtgctgccaaga
gccatgcccagttccatggggggtgggggtggaggcagccccagccctgtggagctacgg
ggggctctggtgggctctgtggaccccacactgcgggagcagcaactgcagcaggagctc
ctggcgctcaagcagcagcagcagctgcagaagcagctcctgttcgctgagttccagaaa
cagcatgaccacctgacaaggcagcatgaggtccagctgcagaagcacctcaagcagcag
caggagatgctggcagccaagcagcagcaggagatgctggcagccaagcggcagcaggag
ctggagcagcagcggcagcgggagcagcagcggcaggaagagctggagaagcagcggctg
gagcagcagctgctcatcctgcggaacaaggagaagagcaaagagagtgccattgccagc
actgaggtaaagctgaggctccaggaattcctcttgtcgaagtcaaaggagcccacacca
ggcggcctcaaccattccctcccacagcaccccaaatgctggggagcccaccatgcttct
ttggaccagagttcccctccccagagcggcccccctgggacgcctccctcctacaaactg
cctttgcctgggccctacgacagtcgagacgacttccccctccgcaaaacagcctctgaa
cccaacttgaaagtgcgttcaaggctaaaacagaaggtggctgagcggagaagcagtccc
ctcctgcgtcgcaaggatgggactgttattagcacctttaagaagagagctgttgagatc
acaggtgccgggcctggggcgtcgtccgtgtgtaacagcgcacccggctccggccccagc
tctcccaacagctcccacagcaccatcgctgagaatggctttactggctcagtccccaac
atccccactgagatgctccctcagcaccgagccctccctctggacagctcccccaaccag
ttcagcctctacacgtctccttctctgcccaacatctccctagggctgcaggccacggtc
actgtcaccaactcacacctcactgcctccccgaagctgtcgacacagcaggaggccgag
aggcaggccctccagtccctgcggcagggtggcacgctgaccggcaagttcatgagcaca
tcctctattcctggctgcctgctgggcgtggcactggagggcgacgggagcccccacggg
catgcctccctgctgcagcatgtgctgttgctggagcaggcccggcagcagagcaccctc
attgctgtgccactccacgggcagtccccactagtgacgggtgaacgtgtggccaccagc
atgcggacggtaggcaagctcccgcggcatcggcccctgagccgcactcagtcctcaccg
ctgccgcagagtccccaggccctgcagcagctggtcatgcaacaacagcaccagcagttc
ctggagaagcagaagcagcagcagctacagctgggcaagatcctcaccaagacaggggag
ctgcccaggcagcccaccacccaccctgaggagacagaggaggagctgacggagcagcag
gaggtcttgctgggggagggagccctgaccatgccccgggagggctccacagagagtgag
agcacacaggaagacctggaggaggaggacgaggaagacgatggggaggaggaggaggat
tgcatccaggttaaggacgaggagggcgagagtggtgctgaggaggggcccgacttggag
gagcctggtgctggatacaaaaaactgttctcagatgcccagccgctgcagcctttgcag
gtgtaccaggcgcccctcagcctggccactgtgccccaccaggccctgggccgtacccag
tcctcccctgctgcccctgggggcatgaagagccccccagaccagcccgtcaagcacctc
ttcaccacaggtgtggtctacgacacgttcatgctaaagcaccagtgcatgtgcgggaac
acacacgtgcaccctgagcatgctggccggatccagagcatctggtcccggctgcaggag
acaggcctgcttagcaagtgcgagcggatccgaggtcgcaaagccacgctagatgagatc
cagacagtgcactctgaataccacaccctgctctatgggaccagtcccctcaaccggcag
aagctagacagcaagaagttgctcggccccatcagccagaagatgtatgctgtgctgcct
tgtgggggcatcggggtggacagtgacaccgtgtggaatgagatgcactcctccagtgct
gtgcgcatggcagtgggctgcctgctggagctggccttcaaggtggctgcaggagagctc
aagaatggatttgccatcatccggcccccaggacaccacgccgaggaatccacagccatg
ggattctgcttcttcaactctgtagccatcaccgcaaaactcctacagcagaagttgaac
gtgggcaaggtcctcatcgtggactgggacattcaccatggcaatggcacccagcaggcg
ttctacaatgacccctctgtgctctacatctctctgcatcgctatgacaacgggaacttc
tttccaggctctggggctcctgaagaggttggtggaggaccaggcgtggggtacaatgtg
aacgtggcatggacaggaggtgtggacccccccattggagacgtggagtaccttacagcc
ttcaggacagtggtgatgcccattgcccacgagttctcacctgatgtggtcctagtctcc
gccgggtttgatgctgttgaaggacatctgtctcctctgggtggctactctgtcaccgcc
agatgttttggccacttgaccaggcagctgatgaccctggcagggggccgggtggtgctg
gccctggagggaggccatgacttgaccgccatctgtgatgcctctgaggcttgtgtctcg
gctctgctcagtgtagagctgcagcccttggatgaggcagtcttgcagcaaaagcccaac
atcaacgcagtggccacgctagagaaagtcatcgagatccagagcaaacactggagctgt
gtgcagaagttcgccgctggtctgggccggtccctgcgagaggcccaagcaggtgagacc
gaggaggccgagactgtgagcgccatggccttgctgtcggtgggggccgagcaggcccag
gctgcggcagcccgggaacacagccccaggccggcagaggagcccatggagcaggagcct
gccctgtga

KEGG   Homo sapiens (human): 3065Help
Entry
3065              CDS       T01001                                 

Gene name
HDAC1, GON-10, HD1, KDAC1, RPD3, RPD3L1
Definition
(RefSeq) histone deacetylase 1
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
Network
nt06123  TNF signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tacedinaline: D05988
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3065 (HDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    3065 (HDAC1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3065 (HDAC1)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3065 (HDAC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3065 (HDAC1)
   05202 Transcriptional misregulation in cancer
    3065 (HDAC1)
   05206 MicroRNAs in cancer
    3065 (HDAC1)
   05203 Viral carcinogenesis
    3065 (HDAC1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    3065 (HDAC1)
  09164 Neurodegenerative disease
   05016 Huntington disease
    3065 (HDAC1)
  09165 Substance dependence
   05031 Amphetamine addiction
    3065 (HDAC1)
   05034 Alcoholism
    3065 (HDAC1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3065 (HDAC1)
   05165 Human papillomavirus infection
    3065 (HDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3065 (HDAC1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3065 (HDAC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3065 (HDAC1)
   HDAC complexes
    Sin3A-HDAC complex
     3065 (HDAC1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3065 (HDAC1)
  Chromatin remodeling factors
   NuRD complex
    3065 (HDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3065
NCBI-ProteinID: NP_004955
OMIM: 601241
HGNC: 4852
Ensembl: ENSG00000116478
Vega: OTTHUMG00000007529
Pharos: Q13547(Tclin)
UniProt: Q13547 Q6IT96
LinkDB All DBs
Structure
PDB: 

Position
1p35.2-p35.1
AA seq 482 aa AA seqDB search
MAQTQGTRRKVCYYYDGDVGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKAN
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHG
DGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMEMFQPSAVVLQCGSDSLSGDRLGCFNLTIKGHAKCVEFVKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALDTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKRISICSSDKRIACEEEF
SDSEEEGEGGRKNSSNFKKAKRVKTEDEKEKDPEEKKEVTEEEKTKEEKPEAKGVKEEVK
LA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagacgcagggcacccggaggaaagtctgttactactacgacggggatgttgga
aattactattatggacaaggccacccaatgaagcctcaccgaatccgcatgactcataat
ttgctgctcaactatggtctctaccgaaaaatggaaatctatcgccctcacaaagccaat
gctgaggagatgaccaagtaccacagcgatgactacattaaattcttgcgctccatccgt
ccagataacatgtcggagtacagcaagcagatgcagagattcaacgttggtgaggactgt
ccagtattcgatggcctgtttgagttctgtcagttgtctactggtggttctgtggcaagt
gctgtgaaacttaataagcagcagacggacatcgctgtgaattgggctgggggcctgcac
catgcaaagaagtccgaggcatctggcttctgttacgtcaatgatatcgtcttggccatc
ctggaactgctaaagtatcaccagagggtgctgtacattgacattgatattcaccatggt
gacggcgtggaagaggccttctacaccacggaccgggtcatgactgtgtcctttcataag
tatggagagtacttcccaggaactggggacctacgggatatcggggctggcaaaggcaag
tattatgctgttaactacccgctccgagacgggattgatgacgagtcctatgaggccatt
ttcaagccggtcatgtccaaagtaatggagatgttccagcctagtgcggtggtcttacag
tgtggctcagactccctatctggggatcggttaggttgcttcaatctaactatcaaagga
cacgccaagtgtgtggaatttgtcaagagctttaacctgcctatgctgatgctgggaggc
ggtggttacaccattcgtaacgttgcccggtgctggacatatgagacagctgtggccctg
gatacggagatccctaatgagcttccatacaatgactactttgaatactttggaccagat
ttcaagctccacatcagtccttccaatatgactaaccagaacacgaatgagtacctggag
aagatcaaacagcgactgtttgagaaccttagaatgctgccgcacgcacctggggtccaa
atgcaggcgattcctgaggacgccatccctgaggagagtggcgatgaggacgaagacgac
cctgacaagcgcatctcgatctgctcctctgacaaacgaattgcctgtgaggaagagttc
tccgattctgaagaggagggagaggggggccgcaagaactcttccaacttcaaaaaagcc
aagagagtcaaaacagaggatgaaaaagagaaagacccagaggagaagaaagaagtcacc
gaagaggagaaaaccaaggaggagaagccagaagccaaaggggtcaaggaggaggtcaag
ttggcctga

KEGG   Homo sapiens (human): 3066Help
Entry
3066              CDS       T01001                                 

Gene name
HDAC2, HD2, KDAC2, RPD3, YAF1
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04213  Longevity regulating pathway - multiple species
hsa04330  Notch signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05016  Huntington disease
hsa05034  Alcoholism
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05220  Chronic myeloid leukemia
Network
nt06123  TNF signaling (viruses)
nt06166  Human papillomavirus (HPV)
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
N00375  HPV E7 to TNF-IRF1 signaling pathway
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3066 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    3066 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3066 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    3066 (HDAC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3066 (HDAC2)
   05202 Transcriptional misregulation in cancer
    3066 (HDAC2)
   05206 MicroRNAs in cancer
    3066 (HDAC2)
   05203 Viral carcinogenesis
    3066 (HDAC2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    3066 (HDAC2)
  09164 Neurodegenerative disease
   05016 Huntington disease
    3066 (HDAC2)
  09165 Substance dependence
   05034 Alcoholism
    3066 (HDAC2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3066 (HDAC2)
   05165 Human papillomavirus infection
    3066 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3066 (HDAC2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     3066 (HDAC2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     3066 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     3066 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    3066 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    3066 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 3066
NCBI-ProteinID: NP_001518
OMIM: 605164
HGNC: 4853
Ensembl: ENSG00000196591
Vega: OTTHUMG00000015411
Pharos: Q92769(Tclin)
UniProt: Q92769
LinkDB All DBs
Structure
PDB: 

Position
6q21
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGT
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcaaggaggcggcaaaaaaaaagtctgctactactacgacggtgatatt
ggaaattattattatggacagggtcatcccatgaagcctcatagaatccgcatgacccat
aacttgctgttaaattatggcttatacagaaaaatggaaatatataggccccataaagcc
actgccgaagaaatgacaaaatatcacagtgatgagtatatcaaatttctacggtcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaagat
tgtccagtgtttgatggactctttgagttttgtcagctctcaactggcggttcagttgct
ggagctgtgaagttaaaccgacaacagactgatatggctgttaattgggctggaggatta
catcatgctaagaaatcagaagcatcaggattctgttacgttaatgatattgtgcttgcc
atccttgaattactaaagtatcatcagagagtcttatatattgatatagatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgtaatgacggtatcattccat
aaatatggggaatactttcctggcacaggagacttgagggatattggtgctggaaaaggc
aaatactatgctgtcaattttccaatgagagatggtatagatgatgagtcatatgggcag
atatttaagcctattatctcaaaggtgatggagatgtatcaacctagtgctgtggtatta
cagtgtggtgcagactcattatctggtgatagactgggttgtttcaatctaacagtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaacttttaacttaccattactgatgcttgga
ggaggtggctacacaatccgtaatgttgctcgatgttggacatatgagactgcagttgcc
cttgattgtgagattcccaatgagttgccatataatgattactttgagtattttggacca
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttgtttgaaaatttgcgcatgttacctcatgcacctggtgtc
cagatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagatggagaa
gatccagacaagagaatttctattcgagcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggatgaaggagaaggaggtcgaagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaagaagataagaaagaaacagaggacaaaaaaacagac
gttaaggaagaagataaatccaaggacaacagtggtgaaaaaacagataccaaaggaacc
aaatcagaacagctcagcaacccctga

KEGG   Homo sapiens (human): 51564Help
Entry
51564             CDS       T01001                                 

Gene name
HDAC7, HD7, HD7A, HDAC7A
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    51564 (HDAC7)
  09165 Substance dependence
   05034 Alcoholism
    51564 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    51564 (HDAC7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     51564 (HDAC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     51564 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 51564
NCBI-ProteinID: NP_001091886
OMIM: 606542
HGNC: 14067
Ensembl: ENSG00000061273
Vega: OTTHUMG00000152968
Pharos: Q8WUI4(Tclin)
UniProt: Q8WUI4
LinkDB All DBs
Structure
PDB: 

Position
12q13.11
AA seq 954 aa AA seqDB search
MHSPGADGTQVSPGAHYCSPTGAGCPRPCADTPGPQPQPMDLRVGQRPPVEPPPEPTLLA
LQRPQRLHHHLFLAGLQQQRSVEPMRLSMDTPMPELQVGPQEQELRQLLHKDKSKRSAVA
SSVVKQKLAEVILKKQQAALERTVHPNSPGIPYRTLEPLETEGATRSMLSSFLPPVPSLP
SDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKESAPPSLRRRPAETLGDSSPSS
SSTPASGCSSPNDSEHGPNPILGSEADSDRRTHPTLGPRGPILGSPHTPLFLPHGLEPEA
GGTLPSRLQPILLLDPSGSHAPLLTVPGLGPLPFHFAQSLMTTERLSGSGLHWPLSRTRS
EPLPPSATAPPPPGPMQPRLEQLKTHVQVIKRSAKPSEKPRLRQIPSAEDLETDGGGPGQ
VVDDGLEHRELGHGQPEARGPAPLQQHPQVLLWEQQRLAGRLPRGSTGDTVLLPLAQGGH
RPLSRAQSSPAAPASLSAPEPASQARVLSSSETPARTLPFTTGLIYDSVMLKHQCSCGDN
SRHPEHAGRIQSIWSRLQERGLRSQCECLRGRKASLEELQSVHSERHVLLYGTNPLSRLK
LDNGKLAGLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELK
NGFAVVRPPGHHADHSTAMGFCFFNSVAIACRQLQQQSKASKILIVDWDVHHGNGTQQTF
YQDPSVLYISLHRHDDGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAF
RIVVMPIAREFSPDLVLVSAGFDAAEGHPAPLGGYHVSAKCFGYMTQQLMNLAGGAVVLA
LEGGHDLTAICDASEACVAALLGNRVDPLSEEGWKQKPNLNAIRSLEAVIRVHSKYWGCM
QRLASCPDSWVPRVPGADKEEVEAVTALASLSVGILAEDRPSEQLVEEEEPMNL
NT seq 2865 nt NT seq  +upstreamnt  +downstreamnt
atgcacagccccggcgctgatgggacccaggtgagcccgggtgcccactactgcagcccc
actggcgcaggctgccccaggccctgtgcagacacaccaggccctcagccgcagcccatg
gacctgcgggtgggccagcggcccccagtggagcccccaccagagcccacattgctggcc
ctgcagcgtccccagcgcctgcaccaccacctcttcctagcaggcctgcagcagcagcgc
tcggtggagcccatgaggctctccatggacacgccgatgcccgagttgcaggtgggaccc
caggaacaagagctgcggcagcttctccacaaggacaagagcaagcgaagtgctgtagcc
agcagcgtggtcaagcagaagctagcggaggtgattctgaaaaaacagcaggcggcccta
gaaagaacagtccatcccaacagccccggcattccctacagaaccctggagcccctggag
acggaaggagccacccgctccatgctcagcagctttttgcctcctgttcccagcctgccc
agtgaccccccagagcacttccctctgcgcaagacagtctctgagcccaacctgaagctg
cgctataagcccaagaagtccctggagcggaggaagaatccactgctccgaaaggagagt
gcgccccccagcctccggcggcggcccgcagagaccctcggagactcctccccaagtagt
agcagcacgcccgcatcagggtgcagctcccccaatgacagcgagcacggccccaatccc
atcctgggctcggaggctgacagtgaccgcaggacccatccgactctgggccctcggggg
ccaatcctggggagcccccacactcccctcttcctgccccatggcttggagcccgaggct
gggggcaccttgccctctcgcctgcagcccattctcctcctggacccctcaggctctcat
gccccgctgctgactgtgcccgggcttgggcccttgcccttccactttgcccagtcctta
atgaccaccgagcggctctctgggtcaggcctccactggccactgagccggactcgctca
gagcccctgccccccagtgccaccgctcccccaccgccgggccccatgcagccccgcctg
gagcagctcaaaactcacgtccaggtgatcaagaggtcagccaagccgagtgagaagccc
cggctgcggcagataccctcggctgaagacctggagacagatggcgggggaccgggccag
gtggtggacgatggcctggagcacagggagctgggccatgggcagcctgaggccagaggc
cccgctcctctccagcagcaccctcaggtgttgctctgggaacagcagcgactggctggg
cggctcccccggggcagcaccggggacactgtgctgcttcctctggcccagggtgggcac
cggcctctgtcccgggctcagtcttccccagccgcacctgcctcactgtcagccccagag
cctgccagccaggcccgagtcctctccagctcagagacccctgccaggaccctgcccttc
accacagggctgatctatgactcggtcatgctgaagcaccagtgctcctgcggtgacaac
agcaggcacccggagcacgccggccgcatccagagcatctggtcccggctgcaggagcgg
gggctccggagccagtgtgagtgtctccgaggccggaaggcctccctggaagagctgcag
tcggtccactctgagcggcacgtgctcctctacggcaccaacccgctcagccgcctcaaa
ctggacaacgggaagctggcagggctcctggcacagcggatgtttgtgatgctgccctgt
ggtggggttggggtggacactgacaccatctggaatgagcttcattcctccaatgcagcc
cgctgggccgctggcagtgtcactgacctcgccttcaaagtggcttctcgtgagctaaag
aatggtttcgctgtggtgcggcccccaggacaccatgcagatcattcaacagccatgggc
ttctgcttcttcaactcagtggccatcgcctgccggcagctgcaacagcagagcaaggcc
agcaagatcctcattgtagactgggacgtgcaccatggcaacggcacccagcaaaccttc
taccaagaccccagtgtgctctacatctccctgcatcgccatgacgacggcaacttcttc
ccggggagtggggctgtggatgaggtaggggctggcagcggtgagggcttcaatgtcaat
gtggcctgggctggaggtctggacccccccatgggggatcctgagtacctggctgctttc
aggatagtcgtgatgcccatcgcccgagagttctctccagacctagtcctggtgtctgct
ggatttgatgctgctgagggtcacccggccccactgggtggctaccatgtttctgccaaa
tgttttggatacatgacgcagcaactgatgaacctggcaggaggcgcagtggtgctggcc
ttggagggtggccatgacctcacagccatctgtgacgcctctgaggcctgtgtggctgct
cttctgggtaacagggtggatcccctttcagaagaaggctggaaacagaaacccaacctc
aatgccatccgctctctggaggccgtgatccgggtgcacagtaaatactggggctgcatg
cagcgcctggcctcctgtccagactcctgggtgcctagagtgccaggggctgacaaagaa
gaagtggaggcagtgaccgcactggcgtccctctctgtgggcatcctggctgaagatagg
ccctcggagcagctggtggaggaggaagaacctatgaatctctaa

KEGG   Homo sapiens (human): 55869Help
Entry
55869             CDS       T01001                                 

Gene name
HDAC8, CDA07, CDLS5, HD8, HDACL1, KDAC8, MRXS6, RPD3, WTS
Definition
(RefSeq) histone deacetylase 8
  KO
K11405  histone deacetylase 8 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Disease
H00631  Cornelia de Lange syndrome
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    55869 (HDAC8)
  09165 Substance dependence
   05034 Alcoholism
    55869 (HDAC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55869 (HDAC8)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     55869 (HDAC8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     55869 (HDAC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl DNase-RNase
Motif
Other DBs
NCBI-GeneID: 55869
NCBI-ProteinID: NP_060956
OMIM: 300269
HGNC: 13315
Ensembl: ENSG00000147099
Vega: OTTHUMG00000021814
Pharos: Q9BY41(Tclin)
UniProt: Q9BY41
LinkDB All DBs
Structure
PDB: 

Position
Xq13.1
AA seq 377 aa AA seqDB search
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggagccggaggaaccggcggacagtgggcagtcgctggtcccggtttatatctat
agtcccgagtatgtcagtatgtgtgactccctggccaagatccccaaacgggccagtatg
gtgcattctttgattgaagcatatgcactgcataagcagatgaggatagttaagcctaaa
gtggcctccatggaggagatggccaccttccacactgatgcttatctgcagcatctccag
aaggtcagccaagagggcgatgatgatcatccggactccatagaatatgggctaggttat
gactgcccagccactgaagggatatttgactatgcagcagctataggaggggctacgatc
acagctgcccaatgcctgattgacggaatgtgcaaagtagcaattaactggtctggaggg
tggcatcatgcaaagaaagatgaagcatctggtttttgttatctcaatgatgctgtcctg
ggaatattacgattgcgacggaaatttgagcgtattctctacgtggatttggatctgcac
catggagatggtgtagaagacgcattcagtttcacctccaaagtcatgaccgtgtccctg
cacaaattctccccaggatttttcccaggaacaggtgacgtgtctgatgttggcctaggg
aagggacggtactacagtgtaaatgtgcccattcaggatggcatacaagatgaaaaatat
taccagatctgtgaaagtgtactaaaggaagtataccaagcctttaatcccaaagcagtg
gtcttacagctgggagctgacacaatagctggggatcccatgtgctcctttaacatgact
ccagtgggaattggcaagtgtcttaagtacatccttcaatggcagttggcaacactcatt
ttgggaggaggaggctataaccttgccaacacggctcgatgctggacatacttgaccggg
gtcatcctagggaaaacactatcctctgagatcccagatcatgagtttttcacagcatat
ggtcctgattatgtgctggaaatcacgccaagctgccggccagaccgcaatgagccccac
cgaatccaacaaatcctcaactacatcaaagggaatctgaagcatgtggtctag

KEGG   Homo sapiens (human): 79885Help
Entry
79885             CDS       T01001                                 

Gene name
HDAC11, HD11
Definition
(RefSeq) histone deacetylase 11
  KO
K11418  histone deacetylase 11 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Mocetinostat (DG01404): D09357 D09641
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    79885 (HDAC11)
  09165 Substance dependence
   05034 Alcoholism
    79885 (HDAC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    79885 (HDAC11)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     79885 (HDAC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class IV HDACs
     79885 (HDAC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 79885
NCBI-ProteinID: NP_079103
OMIM: 607226
HGNC: 19086
Ensembl: ENSG00000163517
Vega: OTTHUMG00000129800
Pharos: Q96DB2(Tclin)
UniProt: Q96DB2 A0A024R2I1
LinkDB All DBs
Position
3p25.1
AA seq 347 aa AA seqDB search
MLHTTQLYQHVPETRWPIVYSPRYNITFMGLEKLHPFDAGKWGKVINFLKEEKLLSDSML
VEAREASEEDLLVVHTRRYLNELKWSFAVATITEIPPVIFLPNFLVQRKVLRPLRTQTGG
TIMAGKLAVERGWAINVGGGFHHCSSDRGGGFCAYADITLAIKFLFERVEGISRATIIDL
DAHQGNGHERDFMDDKRVYIMDVYNRHIYPGDRFAKQAIRRKVELEWGTEDDEYLDKVER
NIKKSLQEHLPDVVVYNAGTDILEGDRLGGLSISPAGIVKRDELVFRMVRGRRVPILMVT
SGGYQKRTARIIADSILNLFGLGLIGPESPSVSAQNSDTPLLPPAVP
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgctacacacaacccagctgtaccagcatgtgccagagacacgctggccaatcgtgtac
tcgccgcgctacaacatcaccttcatgggcctggagaagctgcatccctttgatgccgga
aaatggggcaaagtgatcaatttcctaaaagaagagaagcttctgtctgacagcatgctg
gtggaggcgcgggaggcctcggaggaggacctgctggtggtgcacacgaggcgctatctt
aatgagctcaagtggtcctttgctgttgctaccatcacagaaatcccccccgttatcttc
ctccccaacttccttgtgcagaggaaggtgctgaggccccttcggacccagacaggagga
accataatggcggggaagctggctgtggagcgaggctgggccatcaacgtggggggtggc
ttccaccactgctccagcgaccgtggcgggggcttctgtgcctatgcggacatcacgctc
gccatcaagtttctgtttgagcgtgtggagggcatctccagggctaccatcattgatctt
gatgcccatcagggcaatgggcatgagcgagacttcatggacgacaagcgtgtgtacatc
atggatgtctacaaccgccacatctacccaggggaccgctttgccaagcaggccatcagg
cggaaggtggagctggagtggggcacagaggatgatgagtacctggataaggtggagagg
aacatcaagaaatccctccaggagcacctgcccgacgtggtggtatacaatgcaggcacc
gacatcctcgagggggaccgccttggggggctgtccatcagcccagcgggcatcgtgaag
cgggatgagctggtgttccggatggtccgtggccgccgggtgcccatccttatggtgacc
tcaggcgggtaccagaagcgcacagcccgcatcattgctgactccatacttaatctgttt
ggcctggggctcattgggcctgagtcacccagcgtctccgcacagaactcagacacaccg
ctgcttccccctgcagtgccctga

KEGG   Homo sapiens (human): 83933Help
Entry
83933             CDS       T01001                                 

Gene name
HDAC10, HD10
Definition
(RefSeq) histone deacetylase 10
  KO
K18671  histone deacetylase 10 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    83933 (HDAC10)
  09165 Substance dependence
   05034 Alcoholism
    83933 (HDAC10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83933 (HDAC10)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     83933 (HDAC10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     83933 (HDAC10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 83933
NCBI-ProteinID: NP_114408
OMIM: 608544
HGNC: 18128
Ensembl: ENSG00000100429
Vega: OTTHUMG00000044647
Pharos: Q969S8(Tclin)
UniProt: Q969S8
LinkDB All DBs
Position
22q13.33
AA seq 669 aa AA seqDB search
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcgcttgtgtaccatgaggacatgacggccacccggctgctctgggacgac
cccgagtgcgagatcgagcgtcctgagcgcctgaccgcagccctggatcgcctgcggcag
cgcggcctggaacagaggtgtctgcggttgtcagcccgcgaggcctcggaagaggagctg
ggcctggtgcacagcccagagtatgtatccctggtcagggagacccaggtcctaggcaag
gaggagctgcaggcgctgtccggacagttcgacgccatctacttccacccgagtaccttt
cactgcgcgcggctggccgcaggggctggactgcagctggtggacgctgtgctcactgga
gctgtgcaaaatgggcttgccctggtgaggcctcccgggcaccatggccagagggcggct
gccaacgggttctgtgtgttcaacaacgtggccatagcagctgcacatgccaagcagaaa
cacgggctacacaggatcctcgtcgtggactgggatgtgcaccatggccaggggatccag
tatctctttgaggatgaccccagcgtcctttacttctcctggcaccgctatgagcatggg
cgcttctggcctttcctgcgagagtcagatgcagacgcagtggggcggggacagggcctc
ggcttcactgtcaacctgccctggaaccaggttgggatgggaaacgctgactacgtggct
gccttcctgcacctgctgctcccactggcctttgagtttgaccctgagctggtgctggtc
tcggcaggatttgactcagccatcggggaccctgaggggcaaatgcaggccacgccagag
tgcttcgcccacctcacacagctgctgcaggtgctggccggcggccgggtctgtgccgtg
ctggagggcggctaccacctggagtcactggcggagtcagtgtgcatgacagtacagacg
ctgctgggtgacccggccccacccctgtcagggccaatggcgccatgtcagagtgcccta
gagtccatccagagtgcccgtgctgcccaggccccgcactggaagagcctccagcagcaa
gatgtgaccgctgtgccgatgagccccagcagccactccccagaggggaggcctccacct
ctgctgcctgggggtccagtgtgtaaggcagctgcatctgcaccgagctccctcctggac
cagccgtgcctctgccccgcaccctctgtccgcaccgctgttgccctgacaacgccggat
atcacattggttctgccccctgacgtcatccaacaggaagcgtcagccctgagggaggag
acagaagcctgggccaggccacacgagtccctggcccgggaggaggccctcactgcactt
gggaagctcctgtacctcttagatgggatgctggatgggcaggtgaacagtggtatagca
gccactccagcctctgctgcagcagccaccctggatgtggctgttcggagaggcctgtcc
cacggagcccagaggctgctgtgcgtggccctgggacagctggaccggcctccagacctc
gcccatgacgggaggagtctgtggctgaacatcaggggcaaggaggcggctgccctatcc
atgttccatgtctccacgccactgccagtgatgaccggtggtttcctgagctgcatcttg
ggcttggtgctgcccctggcctatggcttccagcctgacctggtgctggtggcgctgggg
cctggccatggcctgcagggcccccacgctgcactcctggctgcaatgcttcgggggctg
gcagggggccgagtcctggccctcctggaggagaactccacaccccagctagcagggatc
ctggcccgggtgctgaatggagaggcacctcctagcctaggcccttcctctgtggcctcc
ccagaggacgtccaggccctgatgtacctgagagggcagctggagcctcagtggaagatg
ttgcagtgccatcctcacctggtggcttga

KEGG   Homo sapiens (human): 8841Help
Entry
8841              CDS       T01001                                 

Gene name
HDAC3, HD3, KDAC3, RPD3, RPD3-2
Definition
(RefSeq) histone deacetylase 3
  KO
K11404  histone deacetylase 3 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04919  Thyroid hormone signaling pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Mocetinostat (DG01404): D09357 D09641
Nanatinostat: D11442
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Tinostamustine: D11182
Tucidinostat: D10993
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    8841 (HDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    8841 (HDAC3)
  09165 Substance dependence
   05034 Alcoholism
    8841 (HDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8841 (HDAC3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     8841 (HDAC3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     8841 (HDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8841
NCBI-ProteinID: NP_003874
OMIM: 605166
HGNC: 4854
Ensembl: ENSG00000171720
Vega: OTTHUMG00000129629
Pharos: O15379(Tclin)
UniProt: O15379
LinkDB All DBs
Structure
PDB: 

Position
5q31.3
AA seq 428 aa AA seqDB search
MAKTVAYFYDPDVGNFHYGAGHPMKPHRLALTHSLVLHYGLYKKMIVFKPYQASQHDMCR
FHSEDYIDFLQRVSPTNMQGFTKSLNAFNVGDDCPVFPGLFEFCSRYTGASLQGATQLNN
KICDIAINWAGGLHHAKKFEASGFCYVNDIVIGILELLKYHPRVLYIDIDIHHGDGVQEA
FYLTDRVMTVSFHKYGNYFFPGTGDMYEVGAESGRYYCLNVPLRDGIDDQSYKHLFQPVI
NQVVDFYQPTCIVLQCGADSLGCDRLGCFNLSIRGHGECVEYVKSFNIPLLVLGGGGYTV
RNVARCWTYETSLLVEEAISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQ
TIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDN
DKESDVEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaccgtggcctatttctacgaccccgacgtgggcaacttccactacggagct
ggacaccctatgaagccccatcgcctggcattgacccatagcctggtcctgcattacggt
ctctataagaagatgatcgtcttcaagccataccaggcctcccaacatgacatgtgccgc
ttccactccgaggactacattgacttcctgcagagagtcagccccaccaatatgcaaggc
ttcaccaagagtcttaatgccttcaacgtaggcgatgactgcccagtgtttcccgggctc
tttgagttctgctcgcgttacacaggcgcatctctgcaaggagcaacccagctgaacaac
aagatctgtgatattgccattaactgggctggtggtctgcaccatgccaagaagtttgag
gcctctggcttctgctatgtcaacgacattgtgattggcatcctggagctgctcaagtac
caccctcgggtgctctacattgacattgacatccaccatggtgacggggttcaagaagct
ttctacctcactgaccgggtcatgacggtgtccttccacaaatacggaaattacttcttc
cctggcacaggtgacatgtatgaagtcggggcagagagtggccgctactactgtctgaac
gtgcccctgcgggatggcattgatgaccagagttacaagcaccttttccagccggttatc
aaccaggtagtggacttctaccaacccacgtgcattgtgctccagtgtggagctgactct
ctgggctgtgatcgattgggctgctttaacctcagcatccgagggcatggggaatgcgtt
gaatatgtcaagagcttcaatatccctctactcgtgctgggtggtggtggttatactgtc
cgaaatgttgcccgctgctggacatatgagacatcgctgctggtagaagaggccattagt
gaggagcttccctatagtgaatacttcgagtactttgccccagacttcacacttcatcca
gatgtcagcacccgcatcgagaatcagaactcacgccagtatctggaccagatccgccag
acaatctttgaaaacctgaagatgctgaaccatgcacctagtgtccagattcatgacgtg
cctgcagacctcctgacctatgacaggactgatgaggctgatgcagaggagaggggtcct
gaggagaactatagcaggccagaggcacccaatgagttctatgatggagaccatgacaat
gacaaggaaagcgatgtggagatttaa

KEGG   Homo sapiens (human): 9734Help
Entry
9734              CDS       T01001                                 

Gene name
HDAC9, HD7, HD7b, HD9, HDAC, HDAC7, HDAC7B, HDAC9B, HDAC9FL, HDRP, MITR
Definition
(RefSeq) histone deacetylase 9
  KO
K11409  histone deacetylase 9 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    9734 (HDAC9)
  09165 Substance dependence
   05034 Alcoholism
    9734 (HDAC9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9734 (HDAC9)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9734 (HDAC9)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9734 (HDAC9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 9734
NCBI-ProteinID: NP_478056
OMIM: 606543
HGNC: 14065
Ensembl: ENSG00000048052
Vega: OTTHUMG00000152487
Pharos: Q9UKV0(Tclin)
UniProt: Q9UKV0
LinkDB All DBs
Position
7p21.1
AA seq 1011 aa AA seqDB search
MHSMISSVDVKSEVPVGLEPISPLDLRTDLRMMMPVVDPVVREKQLQQELLLIQQQQQIQ
KQLLIAEFQKQHENLTRQHQAQLQEHIKELLAIKQQQELLEKEQKLEQQRQEQEVERHRR
EQQLPPLRGKDRGRERAVASTEVKQKLQEFLLSKSATKDTPTNGKNHSVSRHPKLWYTAA
HHTSLDQSSPPLSGTSPSYKYTLPGAQDAKDDFPLRKTASEPNLKVRSRLKQKVAERRSS
PLLRRKDGNVVTSFKKRMFEVTESSVSSSSPGSGPSSPNNGPTGSVTENETSVLPPTPHA
EQMVSQQRILIHEDSMNLLSLYTSPSLPNITLGLPAVPSQLNASNSLKEKQKCETQTLRQ
GVPLPGQYGGSIPASSSHPHVTLEGKPPNSSHQALLQHLLLKEQMRQQKLLVAGGVPLHP
QSPLATKERISPGIRGTHKLPRHRPLNRTQSAPLPQSTLAQLVIQQQHQQFLEKQKQYQQ
QIHMNKLLSKSIEQLKQPGSHLEEAEEELQGDQAMQEDRAPSSGNSTRSDSSACVDDTLG
QVGAVKVKEEPVDSDEDAQIQEMESGEQAAFMQQPFLEPTHTRALSVRQAPLAAVGMDGL
EKHRLVSRTHSSPAASVLPHPAMDRPLQPGSATGIAYDPLMLKHQCVCGNSTTHPEHAGR
IQSIWSRLQETGLLNKCERIQGRKASLEEIQLVHSEHHSLLYGTNPLDGQKLDPRILLGD
DSQKFFSSLPCGGLGVDSDTIWNELHSSGAARMAVGCVIELASKVASGELKNGFAVVRPP
GHHAEESTAMGFCFFNSVAITAKYLRDQLNISKILIVDLDVHHGNGTQQAFYADPSILYI
SLHRYDEGNFFPGSGAPNEVGTGLGEGYNINIAWTGGLDPPMGDVEYLEAFRTIVKPVAK
EFDPDMVLVSAGFDALEGHTPPLGGYKVTAKCFGHLTKQLMTLADGRVVLALEGGHDLTA
ICDASEACVNALLGNELEPLAEDILHQSPNMNAVISLQKIIEIQSMSLKFS
NT seq 3036 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtatgatcagctcagtggatgtgaagtcagaagttcctgtgggcctggagccc
atctcacctttagacctaaggacagacctcaggatgatgatgcccgtggtggaccctgtt
gtccgtgagaagcaattgcagcaggaattacttcttatccagcagcagcaacaaatccag
aagcagcttctgatagcagagtttcagaaacagcatgagaacttgacacggcagcaccag
gctcagcttcaggagcatatcaaggaacttctagccataaaacagcaacaagaactccta
gaaaaggagcagaaactggagcagcagaggcaagaacaggaagtagagaggcatcgcaga
gaacagcagcttcctcctctcagaggcaaagatagaggacgagaaagggcagtggcaagt
acagaagtaaagcagaagcttcaagagttcctactgagtaaatcagcaacgaaagacact
ccaactaatggaaaaaatcattccgtgagccgccatcccaagctctggtacacggctgcc
caccacacatcattggatcaaagctctccaccccttagtggaacatctccatcctacaag
tacacattaccaggagcacaagatgcaaaggatgatttcccccttcgaaaaactgcctct
gagcccaacttgaaggtgcggtccaggttaaaacagaaagtggcagagaggagaagcagc
cccttactcaggcggaaggatggaaatgttgtcacttcattcaagaagcgaatgtttgag
gtgacagaatcctcagtcagtagcagttctccaggctctggtcccagttcaccaaacaat
gggccaactggaagtgttactgaaaatgagacttcggttttgccccctacccctcatgcc
gagcaaatggtttcacagcaacgcattctaattcatgaagattccatgaacctgctaagt
ctttatacctctccttctttgcccaacattaccttggggcttcccgcagtgccatcccag
ctcaatgcttcgaattcactcaaagaaaagcagaagtgtgagacgcagacgcttaggcaa
ggtgttcctctgcctgggcagtatggaggcagcatcccggcatcttccagccaccctcat
gttactttagagggaaagccacccaacagcagccaccaggctctcctgcagcatttatta
ttgaaagaacaaatgcgacagcaaaagcttcttgtagctggtggagttcccttacatcct
cagtctcccttggcaacaaaagagagaatttcacctggcattagaggtacccacaaattg
ccccgtcacagacccctgaaccgaacccagtctgcacctttgcctcagagcacgttggct
cagctggtcattcaacagcaacaccagcaattcttggagaagcagaagcaataccagcag
cagatccacatgaacaaactgctttcgaaatctattgaacaactgaagcaaccaggcagt
caccttgaggaagcagaggaagagcttcagggggaccaggcgatgcaggaagacagagcg
ccctctagtggcaacagcactaggagcgacagcagtgcttgtgtggatgacacactggga
caagttggggctgtgaaggtcaaggaggaaccagtggacagtgatgaagatgctcagatc
caggaaatggaatctggggagcaggctgcttttatgcaacagcctttcctggaacccacg
cacacacgtgcgctctctgtgcgccaagctccgctggctgcggttggcatggatggatta
gagaaacaccgtctcgtctccaggactcactcttcccctgctgcctctgttttacctcac
ccagcaatggaccgccccctccagcctggctctgcaactggaattgcctatgaccccttg
atgctgaaacaccagtgcgtttgtggcaattccaccacccaccctgagcatgctggacga
atacagagtatctggtcacgactgcaagaaactgggctgctaaataaatgtgagcgaatt
caaggtcgaaaagccagcctggaggaaatacagcttgttcattctgaacatcactcactg
ttgtatggcaccaaccccctggacggacagaagctggaccccaggatactcctaggtgat
gactctcaaaagtttttttcctcattaccttgtggtggacttggggtggacagtgacacc
atttggaatgagctacactcgtccggtgctgcacgcatggctgttggctgtgtcatcgag
ctggcttccaaagtggcctcaggagagctgaagaatgggtttgctgttgtgaggccccct
ggccatcacgctgaagaatccacagccatggggttctgcttttttaattcagttgcaatt
accgccaaatacttgagagaccaactaaatataagcaagatattgattgtagatctggat
gttcaccatggaaacggtacccagcaggccttttatgctgaccccagcatcctgtacatt
tcactccatcgctatgatgaagggaactttttccctggcagtggagccccaaatgaggtt
ggaacaggccttggagaagggtacaatataaatattgcctggacaggtggccttgatcct
cccatgggagatgttgagtaccttgaagcattcaggaccatcgtgaagcctgtggccaaa
gagtttgatccagacatggtcttagtatctgctggatttgatgcattggaaggccacacc
cctcctctaggagggtacaaagtgacggcaaaatgttttggtcatttgacgaagcaattg
atgacattggctgatggacgtgtggtgttggctctagaaggaggacatgatctcacagcc
atctgtgatgcatcagaagcctgtgtaaatgcccttctaggaaatgagctggagccactt
gcagaagatattctccaccaaagcccgaatatgaatgctgttatttctttacagaagatc
attgaaattcaaagtatgtctttaaagttctcttaa

KEGG   Homo sapiens (human): 9759Help
Entry
9759              CDS       T01001                                 

Gene name
HDAC4, AHO3, BDMR, HA6116, HD4, HDAC-4, HDAC-A, HDACA
Definition
(RefSeq) histone deacetylase 4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04371  Apelin signaling pathway
hsa05034  Alcoholism
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
Disease
H00561  Brachydactyly-mental retardation syndrome
Drug target
Abexinostat (DG01402): D10060 D10084
Belinostat: D08870
Entinostat: D09338
Fimepinostat: D11319
Panobinostat (DG01403): D10019 D10319
Quisinostat (DG01407): D10321 D10322
Remetinostat: D10977
Romidepsin: D06637
Vorinostat: D06320
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    9759 (HDAC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    9759 (HDAC4)
   05203 Viral carcinogenesis
    9759 (HDAC4)
  09165 Substance dependence
   05034 Alcoholism
    9759 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9759 (HDAC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     9759 (HDAC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     9759 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 9759
NCBI-ProteinID: NP_006028
OMIM: 605314
HGNC: 14063
Ensembl: ENSG00000068024
Vega: OTTHUMG00000133344
Pharos: P56524(Tclin)
UniProt: P56524
LinkDB All DBs
Structure
PDB: 

Position
2q37.3
AA seq 1084 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPARVNHMPSTVDVATALPLQVAPSAVPMDLRLDHQFSLP
VAEPALREQQLQQELLALKQKQQIQRQILIAEFQRQHEQLSRQHEAQLHEHIKQQQEMLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRNLNHCISSDPRYWYGKTQHSSLDQSSPPQSGVSTSYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVTDSACSSAPGSGP
SSPNNSSGSVSAENGIAPAVPSIPAETSLAHRLVAREGSAAPLPLYTSPSLPNITLGLPA
TGPSAGTAGQQDAERLTLPALQQRLSLFPGTHLTPYLSTSPLERDGGAAHSPLLQHMVLL
EQPPAQAPLVTGLGALPLHAQSLVGADRVSPSIHKLRQHRPLGRTQSAPLPQNAQALQHL
VIQQQHQQFLEKHKQQFQQQQLQMNKIIPKPSEPARQPESHPEETEEELREHQALLDEPY
LDRLPGQKEAHAQAGVQVKQEPIESDEEEAEPPREVEPGQRQPSEQELLFRQQALLLEQQ
RIHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPVSVQEPPTKPRFTTGLVYDT
LMLKHQCTCGSSSSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHT
LLYGTNPLNRQKLDSKKLLGSLASVFVRLPCGGVGVDSDTIWNEVHSAGAARLAVGCVVE
LVFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAVAAKLLQQRLSVSKILIVDWD
VHHGNGTQQAFYSDPSVLYMSLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDP
PMGDAEYLAAFRTVVMPIASEFAPDVVLVSSGFDAVEGHPTPLGGYNLSARCFGYLTKQL
MGLAGGRIVLALEGGHDLTAICDASEACVSALLGNELDPLPEKVLQQRPNANAVRSMEKV
MEIHSKYWRCLQRTTSTAGRSLIEAQTCENEEAETVTAMASLSVGVKPAEKRPDEEPMEE
EPPL
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccatccagatggactttctggccgagaccagccagtggagctgctg
aatcctgcccgcgtgaaccacatgcccagcacggtggatgtggccacggcgctgcctctg
caagtggccccctcggcagtgcccatggacctgcgcctggaccaccagttctcactgcct
gtggcagagccggccctgcgggagcagcagctgcagcaggagctcctggcgctcaagcag
aagcagcagatccagaggcagatcctcatcgctgagttccagaggcagcacgagcagctc
tcccggcagcacgaggcgcagctccacgagcacatcaagcaacaacaggagatgctggcc
atgaagcaccagcaggagctgctggaacaccagcggaagctggagaggcaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaag
ggcaaagagagtgccgtggccagcacagaagtgaagatgaagttacaagaatttgtcctc
aataaaaagaaggcgctggcccaccggaatctgaaccactgcatttccagcgaccctcgc
tactggtacgggaaaacgcagcacagttcccttgaccagagttctccaccccagagcgga
gtgtcgacctcctataaccacccggtcctgggaatgtacgacgccaaagatgacttccct
cttaggaaaacagcttctgaaccgaatctgaaattacggtccaggctaaagcagaaagtg
gccgaaagacggagcagccccctgttacgcaggaaagacgggccagtggtcactgctcta
aaaaagcgtccgttggatgtcacagactccgcgtgcagcagcgccccaggctccggaccc
agctcacccaacaacagctccgggagcgtcagcgcggagaacggtatcgcgcccgccgtc
cccagcatcccggcggagacgagtttggcgcacagacttgtggcacgagaaggctcggcc
gctccacttcccctctacacatcgccatccttgcccaacatcacgctgggcctgcctgcc
accggcccctctgcgggcacggcgggccagcaggacgccgagagactcacccttcccgcc
ctccagcagaggctctcccttttccccggcacccacctcactccctacctgagcacctcg
cccttggagcgggacggaggggcagcgcacagccctcttctgcagcacatggtcttactg
gagcagccgccggcacaagcacccctcgtcacaggcctgggagcactgcccctccacgca
cagtccttggttggtgcagaccgggtgtccccctccatccacaagctgcggcagcaccgc
ccactggggcggacccagtcggccccgctgccccagaacgcccaggctctgcagcacctg
gtcatccagcagcagcatcagcagtttctggagaaacacaagcagcagttccagcagcag
caactgcagatgaacaagatcatccccaagccaagcgagccagcccggcagccggagagc
cacccggaggagacggaggaggagctccgtgagcaccaggctctgctggacgagccctac
ctggaccggctgccggggcagaaggaggcgcacgcacaggccggcgtgcaggtgaagcag
gagcccattgagagcgatgaggaagaggcagagcccccacgggaggtggagccgggccag
cgccagcccagtgagcaggagctgctcttcagacagcaagccctcctgctggagcagcag
cggatccaccagctgaggaactaccaggcgtccatggaggccgccggcatccccgtgtcc
ttcggcggccacaggcctctgtcccgggcgcagtcctcacccgcgtctgccaccttcccc
gtgtctgtgcaggagccccccaccaagccgaggttcacgacaggcctcgtgtatgacacg
ctgatgctgaagcaccagtgcacctgcgggagtagcagcagccaccccgagcacgccggg
aggatccagagcatctggtcccgcctgcaggagacgggcctccggggcaaatgcgagtgc
atccgcggacgcaaggccaccctggaggagctacagacggtgcactcggaagcccacacc
ctcctgtatggcacgaaccccctcaaccggcagaaactggacagtaagaaacttctaggc
tcgctcgcctccgtgttcgtccggctcccttgcggtggtgttggggtggacagtgacacc
atatggaacgaggtgcactcggcgggggcagcccgcctggctgtgggctgcgtggtagag
ctggtcttcaaggtggccacaggggagctgaagaatggctttgctgtggtccgcccccct
ggacaccatgcggaggagagcacgcccatgggcttttgctacttcaactccgtggccgtg
gcagccaagcttctgcagcagaggttgagcgtgagcaagatcctcatcgtggactgggac
gtgcaccatggaaacgggacccagcaggctttctacagcgaccccagcgtcctgtacatg
tccctccaccgctacgacgatgggaacttcttcccaggcagcggggctcctgatgaggtg
ggcacagggcccggcgtgggtttcaacgtcaacatggctttcaccggcggcctggacccc
cccatgggagacgctgagtacttggcggccttcagaacggtggtcatgccgatcgccagc
gagtttgccccggatgtggtgctggtgtcatcaggcttcgatgccgtggagggccacccc
acccctcttgggggctacaacctctccgccagatgcttcgggtacctgacgaagcagctg
atgggcctggctggcggccggattgtcctggccctcgagggaggccacgacctgaccgcc
atttgcgacgcctcggaagcatgtgtttctgccttgctgggaaacgagcttgatcctctc
ccagaaaaggttttacagcaaagacccaatgcaaacgctgtccgttccatggagaaagtc
atggagatccacagcaagtactggcgctgcctgcagcgcacaacctccacagcggggcgt
tctctgatcgaggctcagacttgcgagaacgaagaagccgagacggtcaccgccatggcc
tcgctgtccgtgggcgtgaagcccgccgaaaagagaccagatgaggagcccatggaagag
gagccgcccctgtag

DBGET integrated database retrieval system