KEGG   Homo sapiens (human): 1441Help
Entry
1441              CDS       T01001                                 

Gene name
CSF3R, CD114, GCSFR, SCN7
Definition
(RefSeq) colony stimulating factor 3 receptor
  KO
K05061  granulocyte colony-stimulating factor receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Drug target
Balugrastim: D10310
Filgrastim: D03235
Lenograstim: D03247
Leridistim: D04695
Lipegfilgrastim: D10242
Milodistim: D05036
Nartograstim: D03245
Pegfilgrastim: D06889
Pegnartograstim: D05389
Pegteograstim: D11026
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1441 (CSF3R)
   04151 PI3K-Akt signaling pathway
    1441 (CSF3R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1441 (CSF3R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1441 (CSF3R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1441 (CSF3R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    1441 (CSF3R)
   04090 CD molecules [BR:hsa04090]
    1441 (CSF3R)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   1441 (CSF3R)
CD molecules [BR:hsa04090]
 Proteins
  1441 (CSF3R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lep_receptor_Ig fn3 EpoR_lig-bind fn3_2 IL6Ra-bind ObR_Ig
Motif
Other DBs
NCBI-GeneID: 1441
NCBI-ProteinID: NP_000751
OMIM: 138971
HGNC: 2439
Ensembl: ENSG00000119535
Vega: OTTHUMG00000008010
Pharos: Q99062(Tclin)
UniProt: Q99062
LinkDB All DBs
Structure
PDB: 

Position
1p34.3
AA seq 836 aa AA seqDB search
MARLGNCSLTWAALIILLLPGSLEECGHISVSAPIVHLGDPITASCIIKQNCSHLDPEPQ
ILWRLGAELQPGGRQQRLSDGTQESIITLPHLNHTQAFLSCCLNWGNSLQILDQVELRAG
YPPAIPHNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILDCVPK
DGQSHCCIPRKHLLLYQNMGIWVQAENALGTSMSPQLCLDPMDVVKLEPPMLRTMDPSPE
AAPPQAGCLQLCWEPWQPGLHINQKCELRHKPQRGEASWALVGPLPLEALQYELCGLLPA
TAYTLQIRCIRWPLPGHWSDWSPSLELRTTERAPTVRLDTWWRQRQLDPRTVQLFWKPVP
LEEDSGRIQGYVVSWRPSGQAGAILPLCNTTELSCTFHLPSEAQEVALVAYNSAGTSRPT
PVVFSESRGPALTRLHAMARDPHSLWVGWEPPNPWPQGYVIEWGLGPPSASNSNKTWRME
QNGRATGFLLKENIRPFQLYEIIVTPLYQDTMGPSQHVYAYSQEMAPSHAPELHLKHIGK
TWAQLEWVPEPPELGKSPLTHYTIFWTNAQNQSFSAILNASSRGFVLHGLEPASLYHIHL
MAASQAGATNSTVLTLMTLTPEGSELHIILGLFGLLLLLTCLCGTAWLCCSPNRKNPLWP
SVPDPAHSSLGSWVPTIMEEDAFQLPGLGTPPITKLTVLEEDEKKPVPWESHNSSETCGL
PTLVQTYVLQGDPRAVSTQPQSQSGTSDQVLYGQLLGSPTSPGPGHYLRCDSTQPLLAGL
TPSPKSYENLWFQASPLGTLVTPAPSQEDDCVFGPLLNFPLLQGIRVHGMEALGSF
NT seq 2511 nt NT seq  +upstreamnt  +downstreamnt
atggcaaggctgggaaactgcagcctgacttgggctgccctgatcatcctgctgctcccc
ggaagtctggaggagtgcgggcacatcagtgtctcagcccccatcgtccacctgggggat
cccatcacagcctcctgcatcatcaagcagaactgcagccatctggacccggagccacag
attctgtggagactgggagcagagcttcagcccgggggcaggcagcagcgtctgtctgat
gggacccaggaatctatcatcaccctgccccacctcaaccacactcaggcctttctctcc
tgctgcctgaactggggcaacagcctgcagatcctggaccaggttgagctgcgcgcaggc
taccctccagccataccccacaacctctcctgcctcatgaacctcacaaccagcagcctc
atctgccagtgggagccaggacctgagacccacctacccaccagcttcactctgaagagt
ttcaagagccggggcaactgtcagacccaaggggactccatcctggactgcgtgcccaag
gacgggcagagccactgctgcatcccacgcaaacacctgctgttgtaccagaatatgggc
atctgggtgcaggcagagaatgcgctggggaccagcatgtccccacaactgtgtcttgat
cccatggatgttgtgaaactggagccccccatgctgcggaccatggaccccagccctgaa
gcggcccctccccaggcaggctgcctacagctgtgctgggagccatggcagccaggcctg
cacataaatcagaagtgtgagctgcgccacaagccgcagcgtggagaagccagctgggca
ctggtgggccccctccccttggaggcccttcagtatgagctctgcgggctcctcccagcc
acggcctacaccctgcagatacgctgcatccgctggcccctgcctggccactggagcgac
tggagccccagcctggagctgagaactaccgaacgggcccccactgtcagactggacaca
tggtggcggcagaggcagctggaccccaggacagtgcagctgttctggaagccagtgccc
ctggaggaagacagcggacggatccaaggttatgtggtttcttggagaccctcaggccag
gctggggccatcctgcccctctgcaacaccacagagctcagctgcaccttccacctgcct
tcagaagcccaggaggtggcccttgtggcctataactcagccgggacctctcgtcccact
ccggtggtcttctcagaaagcagaggcccagctctgaccagactccatgccatggcccga
gaccctcacagcctctgggtaggctgggagccccccaatccatggcctcagggctatgtg
attgagtggggcctgggcccccccagcgcgagcaatagcaacaagacctggaggatggaa
cagaatgggagagccacggggtttctgctgaaggagaacatcaggccctttcagctctat
gagatcatcgtgactcccttgtaccaggacaccatgggaccctcccagcatgtctatgcc
tactctcaagaaatggctccctcccatgccccagagctgcatctaaagcacattggcaag
acctgggcacagctggagtgggtgcctgagccccctgagctggggaagagcccccttacc
cactacaccatcttctggaccaacgctcagaaccagtccttctccgccatcctgaatgcc
tcctcccgtggctttgtcctccatggcctggagcccgccagtctgtatcacatccacctc
atggctgccagccaggctggggccaccaacagtacagtcctcaccctgatgaccttgacc
ccagaggggtcggagctacacatcatcctgggcctgttcggcctcctgctgttgctcacc
tgcctctgtggaactgcctggctctgttgcagccccaacaggaagaatcccctctggcca
agtgtcccagacccagctcacagcagcctgggctcctgggtgcccacaatcatggaggag
gatgccttccagctgcccggccttggcacgccacccatcaccaagctcacagtgctggag
gaggatgaaaagaagccggtgccctgggagtcccataacagctcagagacctgtggcctc
cccactctggtccagacctatgtgctccagggggacccaagagcagtttccacccagccc
caatcccagtctggcaccagcgatcaggtcctttatgggcagctgctgggcagccccaca
agcccagggccagggcactatctccgctgtgactccactcagcccctcttggcgggcctc
acccccagccccaagtcctatgagaacctctggttccaggccagccccttggggaccctg
gtaaccccagccccaagccaggaggacgactgtgtctttgggccactgctcaacttcccc
ctcctgcaggggatccgggtccatgggatggaggcgctggggagcttctag

DBGET integrated database retrieval system