KEGG   Homo sapiens (human): 3767Help
Entry
3767              CDS       T01001                                 

Gene name
KCNJ11, BIR, HHF2, IKATP, KIR6.2, MODY13, PHHI, TNDM3
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 11
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04930  Type II diabetes mellitus
Disease
H00409  Type II diabetes mellitus
H00410  Maturity onset diabetes of the young (MODY)
H00512  Permanent neonatal diabetes mellitus (PNDM)
H00513  Transient neonatal diabetes mellitus (TNDM)
H01267  Familial hyperinsulinemic hypoglycemia (HHF)
Drug target
Amiodarone (DG00204): D00636 D02910
Bepridil (DG00333): D00631 D07520
Chlorpropamide: D00271
Diazoxide: D00294
Dronedarone (DG00207): D03914
Glibenclamide: D00336
Glymidine: D01356
Levcromakalim: D02385 D02385
Minoxidil: D00418
Mitiglinide: D01854
Nateglinide: D01111
Nicorandil: D01810 D01810
Pinacidil: D05482 D05482
Repaglinide: D00594
Tolazamide: D00379
Tolbutamide (DG00115): D00380 D06177
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    3767 (KCNJ11)
 Human Diseases
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    3767 (KCNJ11)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (KCNJ)
   3767 (KCNJ11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2 Cupin_2
Motif
Other DBs
NCBI-GeneID: 3767
NCBI-ProteinID: NP_001159762
OMIM: 600937
HGNC: 6257
Ensembl: ENSG00000187486
Vega: OTTHUMG00000165914
Pharos: Q14654(Tclin)
UniProt: Q14654
LinkDB All DBs
Structure
PDB: 

Position
11p15.1
AA seq 303 aa AA seqDB search
MAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAIL
ILIVQNIVGLMINAIMLGCIFMKTAQAHRRAETLIFSKHAVIALRHGRLCFMLRVGDLRK
SMIISATIHMQVVRKTTSPEGEVVPLHQVDIPMENGVGGNSIFLVAPLIIYHVIDANSPL
YDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVAEEDGRYS
VDYSKFGNTVKVPTPLCTARQLDEDHSLLEALTLASARGPLRKRSVPMAKAKPKFSISPD
SLS
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggcctggtggctcatcgccttcgcccacggtgacctggcccccagcgagggcactgct
gagccctgtgtcaccagcatccactccttctcgtctgccttccttttctccattgaggtc
caagtgactattggctttggggggcgcatggtgactgaggagtgcccactggccatcctg
atcctcatcgtgcagaacatcgtggggctcatgatcaacgccatcatgcttggctgcatc
ttcatgaagactgcccaagcccaccgcagggctgagaccctcatcttcagcaagcatgcg
gtgatcgccctgcgccacggccgcctctgcttcatgctacgtgtgggtgacctccgcaag
agcatgatcatcagcgccaccatccacatgcaggtggtacgcaagaccaccagccccgag
ggcgaggtggtgcccctccaccaggtggacatccccatggagaacggcgtgggtggcaac
agcatcttcctggtggccccgctgatcatctaccatgtcattgatgccaacagcccactc
tacgacctggcacccagcgacctgcaccaccaccaggacctcgagatcatcgtcatcctg
gaaggcgtggtggaaaccacgggcatcaccacccaggcccgcacctcctacctggccgat
gagatcctgtggggccagcgctttgtgcccattgtagctgaggaggacggacgttactct
gtggactactccaagtttggcaacaccgtcaaagtgcccacaccactctgcacggcccgc
cagcttgatgaggaccacagcctactggaagctctgaccctcgcctcagcccgcgggccc
ctgcgcaagcgcagcgtgcccatggccaaggccaagcccaagttcagcatctctccagat
tccctgtcctga

DBGET integrated database retrieval system