KEGG   Homo sapiens (human): 5609Help
Entry
5609              CDS       T01001                                 

Gene name
MAP2K7, JNKK2, MAPKK7, MEK, MEK_7, MKK7, PRKMK7, SAPKK-4, SAPKK4
Definition
(RefSeq) mitogen-activated protein kinase kinase 7
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04380  Osteoclast differentiation
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa04926  Relaxin signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
  Element
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00446  TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    5609 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5609 (MAP2K7)
   04012 ErbB signaling pathway
    5609 (MAP2K7)
   04668 TNF signaling pathway
    5609 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5609 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5609 (MAP2K7)
   04660 T cell receptor signaling pathway
    5609 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    5609 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    5609 (MAP2K7)
   04926 Relaxin signaling pathway
    5609 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5609 (MAP2K7)
  09158 Development
   04380 Osteoclast differentiation
    5609 (MAP2K7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5609 (MAP2K7)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    5609 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5609 (MAP2K7)
   05161 Hepatitis B
    5609 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5609 (MAP2K7)
   05169 Epstein-Barr virus infection
    5609 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5609 (MAP2K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     5609 (MAP2K7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   5609 (MAP2K7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 5609
NCBI-ProteinID: NP_660186
OMIM: 603014
HGNC: 6847
Ensembl: ENSG00000076984
Vega: OTTHUMG00000137368
Pharos: O14733(Tbio)
UniProt: O14733
LinkDB All DBs
Structure
PDB: 

Position
19p13.2
AA seq 419 aa AA seqDB search
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcctccctggaacagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccccgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctccgggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctgaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgagaagctcaagaagcggatgcagggccccatccccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgt
gccgcctacatggcacccgagcgcattgaccccccagaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttggtggagctggcaacaggacagttt
ccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgcttctgcccggacacatgggcttctcgggggacttccagtccttcgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttcatc
aagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaag
actgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

KEGG   Homo sapiens (human): 6416Help
Entry
6416              CDS       T01001                                 

Gene name
MAP2K4, JNKK, JNKK1, MAPKK4, MEK4, MKK4, PRKMK4, SAPKK-1, SAPKK1, SEK1, SERK1, SKK1
Definition
(RefSeq) mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa04912  GnRH signaling pathway
hsa04926  Relaxin signaling pathway
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
  Element
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00446  TNF-JNK signaling pathway
N00542  EGF-EGFR-RAS-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6416 (MAP2K4)
   04012 ErbB signaling pathway
    6416 (MAP2K4)
   04668 TNF signaling pathway
    6416 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    6416 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    6416 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6416 (MAP2K4)
   04926 Relaxin signaling pathway
    6416 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6416 (MAP2K4)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6416 (MAP2K4)
   05135 Yersinia infection
    6416 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    6416 (MAP2K4)
   05161 Hepatitis B
    6416 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6416 (MAP2K4)
   05169 Epstein-Barr virus infection
    6416 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    6416 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6416 (MAP2K4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     6416 (MAP2K4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE7 family
   6416 (MAP2K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Seadorna_VP7 Haspin_kinase Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 6416
NCBI-ProteinID: NP_003001
OMIM: 601335
HGNC: 6844
Ensembl: ENSG00000065559
Vega: OTTHUMG00000178267
Pharos: P45985(Tchem)
UniProt: P45985
LinkDB All DBs
Structure
PDB: 

Position
17p12
AA seq 399 aa AA seqDB search
MAAPSPSGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARFT
LNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMV
HKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMEL
MSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDRS
GNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYEL
ATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKE
LLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggcagcggcagcggcacc
cccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggtaaa
cgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggtttact
ctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacacagc
attgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgcagag
gacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatggtc
cacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaaaaa
gaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgcccatac
attgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaactc
atgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgttatt
ccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccacttaaaa
gaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacagaagt
ggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgccaag
acaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgcatca
cgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgagttg
gccacaggccgatttccttatccaaagtggaatagtgtatttgatcaactaacacaagtc
gtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagtttc
atcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaagag
cttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgctat
gtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgattga

DBGET integrated database retrieval system