KEGG   Homo sapiens (human): 7150
Entry
7150              CDS       T01001                                 

Gene name
TOP1, TOPI
Definition
(RefSeq) DNA topoisomerase I
  KO
K03163  DNA topoisomerase I [EC:5.6.2.1]
Organism
hsa  Homo sapiens (human)
Drug target
Aclarubicin (DG00699): D01911 D02756
Belotecan: D03225
Cositecan: D09327
Edotecarin: D03954
Elsamitrucin: D03977
Etirinotecan pegol (DG01267): D10367 D10422 D10427
Exatecan mesylate: D01432
Firtecan pegol: D10464
Irinotecan (DG00726): D01061 D08086 D10642
Lurtotecan dihydrochloride: D04822
Pegamotecan: D05385
Rubitecan: D04031
Sacituzumab govitecan: D10985
Tenifatecan: D09679
Topotecan (DG00725): D02168 D08618
Trastuzumab deruxtecan: D11529
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7150 (TOP1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.1  DNA topoisomerase
     7150 (TOP1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Topoisomerases
   7150 (TOP1)
SSDB
Motif
Pfam: Topoisom_I Topoisom_I_N Topo_C_assoc
Other DBs
NCBI-GeneID: 7150
NCBI-ProteinID: NP_003277
OMIM: 126420
HGNC: 11986
Ensembl: ENSG00000198900
Vega: OTTHUMG00000033057
Pharos: P11387(Tclin)
UniProt: P11387 Q9BVT2
LinkDB
Structure
PDB: 

Position
20q12
AA seq 765 aa
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
NT seq 2298 nt   +upstreamnt  +downstreamnt
atgagtggggaccacctccacaacgattcccagatcgaagcggatttccgattgaatgat
tctcataaacacaaagataaacacaaagatcgagaacaccggcacaaagaacacaagaag
gagaaggaccgggaaaagtccaagcatagcaacagtgaacataaagattctgaaaagaaa
cacaaagagaaggagaagaccaaacacaaagatggaagctcagaaaagcataaagacaaa
cataaagacagagacaaggaaaaacgaaaagaggaaaaggttcgagcctctggggatgca
aaaataaagaaggagaaggaaaatggcttctctagtccaccacaaattaaagatgaacct
gaagatgatggctattttgttcctcctaaagaggatataaagccattaaagagacctcga
gatgaggatgatgctgattataaacctaagaaaattaaaacagaagataccaagaaggag
aagaaaagaaaactagaagaagaagaggatggtaaattgaaaaaacccaagaataaagat
aaagataaaaaagttcctgagccagataacaagaaaaagaagccgaagaaagaagaggaa
cagaagtggaaatggtgggaagaagagcgctatcctgaaggcatcaagtggaaattccta
gaacataaaggtccagtatttgccccaccatatgagcctcttccagagaatgtcaagttt
tattatgatggtaaagtcatgaagctgagccccaaagcagaggaagtagctacgttcttt
gcaaaaatgctcgaccatgaatatactaccaaggaaatatttaggaaaaatttctttaaa
gactggagaaaggaaatgactaatgaagagaagaatattatcaccaacctaagcaaatgt
gattttacccagatgagccagtatttcaaagcccagacggaagctcggaaacagatgagc
aaggaagagaaactgaaaatcaaagaggagaatgaaaaattactgaaagaatatggattc
tgtattatggataaccacaaagagaggattgctaacttcaagatagagcctcctggactt
ttccgtggccgcggcaaccaccccaagatgggcatgctgaagagacgaatcatgcccgag
gatataatcatcaactgtagcaaagatgccaaggttccttctcctcctccaggacataag
tggaaagaagtccggcatgataacaaggttacttggctggtttcctggacagagaacatc
caaggttccattaaatacatcatgcttaaccctagttcacgaatcaagggtgagaaggac
tggcagaaatacgagactgctcggcggctgaaaaaatgtgtggacaagatccggaaccag
tatcgagaagactggaagtccaaagagatgaaagtccggcagagagctgtagccctgtac
ttcatcgacaagcttgctctgagagcaggcaatgaaaaggaggaaggagaaacagcggac
actgtgggctgctgctcacttcgtgtggagcacatcaatctacacccagagttggatggt
caggaatatgtggtagagtttgacttcctcgggaaggactccatcagatactataacaag
gtccctgttgagaaacgagtttttaagaacctacaactatttatggagaacaagcagccc
gaggatgatctttttgatagactcaatactggtattctgaataagcatcttcaggatctc
atggagggcttgacagccaaggtattccgtacatacaatgcctccatcacgctacagcag
cagctaaaagaactgacagccccggatgagaacatcccagcgaagatcctttcttataac
cgtgccaatcgagctgttgcaattctttgtaaccatcagagggcaccaccaaaaactttt
gagaagtctatgatgaacttgcaaactaagattgatgccaagaaggaacagctagcagat
gcccggagagacctgaaaagtgctaaggctgatgccaaggtcatgaaggatgcaaagacg
aagaaggtagtagagtcaaagaagaaggctgttcagagactggaggaacagttgatgaag
ctggaagttcaagccacagaccgagaggaaaataaacagattgccctgggaacctccaaa
ctcaattatctggaccctaggatcacagtggcttggtgcaagaagtggggtgtcccaatt
gagaagatttacaacaaaacccagcgggagaagtttgcctgggccattgacatggctgat
gaagactatgagttttag

DBGET integrated database retrieval system