KEGG   Homo sapiens (human): 10010
Entry
10010             CDS       T01001                                 

Gene name
TANK, I-TRAF, ITRAF, TRAF2
Definition
(RefSeq) TRAF family member associated NFKB activator
  KO
K12650  TRAF family member-associated NF-kappa-B activator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04140  Autophagy - animal
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05417  Lipid and atherosclerosis
Network
nt06133  RLR signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06263  Hepatocellular carcinoma
  Element
N00469  RIG-I-IRF7/3 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    10010 (TANK)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    10010 (TANK)
   04622 RIG-I-like receptor signaling pathway
    10010 (TANK)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    10010 (TANK)
   05022 Pathways of neurodegeneration - multiple diseases
    10010 (TANK)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    10010 (TANK)
SSDB
Motif
Pfam: TBD DUF3713 PspA_IM30 FliD_N MRF_C1 AAA_13
Other DBs
NCBI-GeneID: 10010
NCBI-ProteinID: NP_001186064
OMIM: 603893
HGNC: 11562
Ensembl: ENSG00000136560
Vega: OTTHUMG00000132037
Pharos: Q92844(Tbio)
UniProt: Q92844 Q6NW12 B2R7S3
LinkDB
Position
2q24.2
AA seq 425 aa
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDKTDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggataaaaacattggcgagcaactcaataaagcgtatgaagccttccggcaggcatgc
atggatagagattctgcagtaaaagaattacagcaaaagactgagaactatgagcagaga
atacgtgaacaacaggaacagctgtcacttcaacagactattattgacaagctaaaatct
cagttacttcttgtgaattccactcaagataacaattatggctgtgttcctctgcttgaa
gacagtgaaacaagaaagaataatttgactcttgatcagccacaagataaagtgatttca
ggaatagcaagagaaaaactaccaaaggtaagaagacaagaggtttcttctcctagaaaa
gaaacttcagcaaggagtcttggcagtcctttgctccatgaaaggggtaatatagagaag
actttctgggatctgaaagaagaatttcataaaatatgcatgctagcaaaagcacagaaa
gaccacttaagcaaacttaatataccagacactgcaactgaaacacagtgctctgtgcct
atacagtgtacggataaaacagataaacaagaagcgctgtttaagcctcaggctaaagat
gatataaatagaggtgcaccatccatcacatctgtcacaccaagaggactgtgcagagat
gaggaagacacctcttttgaatcactttctaaattcaatgtcaagtttccacctatggac
aatgactcaactttcttacatagcactccagagagacccggcatccttagtcctgccacg
tctgaggcagtgtgccaagagaaatttaatatggagttcagagacaacccagggaacttt
gttaaaacagaagaaactttatttgaaattcagggaattgaccccatagcttcagctata
caaaaccttaaaacaactgacaaaacaaagccctcaaatctcgtaaacacttgtatcagg
acaactctggatagagctgcgtgtttgccacctggagaccataatgcattatatgtaaat
agcttcccacttctggacccatctgatgcaccttttccctcactcgattccccgggaaaa
gcaatccgaggaccacagcagcccatttggaagccctttcctaatcaagacagtgactcg
gtggtactaagtggcacagactcagaactgcatatacctcgagtatgtgaattctgtcaa
gcagttttcccaccatccattacatccaggggggatttccttcggcatcttaattcacac
ttcaatggagagacttaa

KEGG   Homo sapiens (human): 64343
Entry
64343             CDS       T01001                                 

Gene name
AZI2, AZ2, NAP1, TILP
Definition
(RefSeq) 5-azacytidine induced 2
  KO
K12651  5-azacytidine-induced protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Network
nt06133  RLR signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06263  Hepatocellular carcinoma
  Element
N00469  RIG-I-IRF7/3 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    64343 (AZI2)
SSDB
Motif
Pfam: TBD Cnn_1N
Other DBs
NCBI-GeneID: 64343
NCBI-ProteinID: NP_071906
OMIM: 609916
HGNC: 24002
Ensembl: ENSG00000163512
Vega: OTTHUMG00000130573
Pharos: Q9H6S1(Tdark)
UniProt: Q9H6S1
LinkDB
Structure
PDB: 
5EP6 5Z7L 5Z7G

Position
3p24.1
AA seq 392 aa
MDALVEDDICILNHEKAHKRDTVTPVSIYSGDESVASHFALVTAYEDIKKRLKDSEKENS
LLKKRIRFLEEKLIARFEEETSSVGREQVNKAYHAYREVCIDRDNLKSKLDKMNKDNSES
LKVLNEQLQSKEVELLQLRTEVETQQVMRNLNPPSSNWEVEKLSCDLKIHGLEQELELMR
KECSDLKIELQKAKQTDPYQEDNLKSRDLQKLSISSDNMQHAYWELKREMSNLHLVTQVQ
AELLRKLKTSTAIKKACAPVGCSEDLGRDSTKLHLMNFTATYTRHPPLLPNGKALCHTTS
SPLPGDVKVLSEKAILQSWTDNERSIPNDGTCFQEHSSYGRNSLEDNSWVFPSPPKSSET
AFGETKTKTLPLPNLPPLHYLDQHNQNCLYKN
NT seq 1179 nt   +upstreamnt  +downstreamnt
atggatgcactggtagaagatgatatctgtattctgaatcatgaaaaagcccataagaga
gatacagtgactccagtttcaatatattcaggagatgaatctgttgcttcccattttgct
cttgtcactgcatatgaagacatcaaaaaacgacttaaggattcagagaaagagaactct
ttgttaaagaagagaataagatttttggaagaaaagctaatagctcgatttgaagaagaa
acaagttccgtgggacgagaacaagtaaataaggcctatcatgcatatcgagaggtttgc
attgatagagataatttgaagagcaaactggacaaaatgaataaagacaactctgaatct
ttgaaagtattgaatgagcagctacaatctaaagaagtagaactcctccagctgaggaca
gaggtggaaactcagcaggtgatgaggaatttaaatccaccttcatcaaactgggaggtg
gaaaagttgagctgtgacctgaagatccatggtttggaacaagagctggaactgatgagg
aaagaatgtagcgatctcaaaatagaactacagaaagccaaacaaacggatccatatcag
gaagacaatctgaagagcagagatctccaaaaactaagcatttcaagtgataatatgcag
catgcatactgggaactgaagagagaaatgtctaatttacatctggtgactcaagtacaa
gctgaactactaagaaaactgaaaacctcaactgcaatcaagaaagcctgtgcccctgta
ggatgcagtgaagaccttggaagagacagcacaaaactgcacttgatgaattttactgca
acatacacaagacatccccctctcttaccaaatggcaaagctctttgtcataccacatct
tcccctttaccaggagatgtaaaggttttatcagagaaagcaatcctccaatcatggaca
gacaatgagagatccattcctaatgatggtacatgctttcaggaacacagttcttatggc
agaaattctctggaagacaattcctgggtatttccaagtcctcctaaatcaagtgagaca
gcatttggggaaactaaaactaaaactttgcctttacccaaccttccaccactgcattac
ttggatcaacataatcagaactgcctttataagaattaa

KEGG   Homo sapiens (human): 9755
Entry
9755              CDS       T01001                                 

Gene name
TBKBP1, ProSAPiP2, SINTBAD
Definition
(RefSeq) TBK1 binding protein 1
  KO
K12652  TANK-binding kinase 1-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04622  RIG-I-like receptor signaling pathway
Network
nt06133  RLR signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06165  Epstein-Barr virus (EBV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06263  Hepatocellular carcinoma
  Element
N00469  RIG-I-IRF7/3 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    9755 (TBKBP1)
SSDB
Motif
Pfam: TBD Zn-C2H2_12 Mod_r Seryl_tRNA_N CT_C_D
Other DBs
NCBI-GeneID: 9755
NCBI-ProteinID: NP_055541
OMIM: 608476
HGNC: 30140
Ensembl: ENSG00000198933
Vega: OTTHUMG00000178286
Pharos: A7MCY6(Tbio)
UniProt: A7MCY6
LinkDB
Position
17q21.32
AA seq 615 aa
MESMFEDDISILTQEALGPSEVWLDSPGDPSLGGDMCSASHFALITAYGDIKERLGGLER
ENATLRRRLKVYEIKYPLISDFGEEHGFSLYEIKDGSLLEVEKVSLQQRLNQFQHELQKN
KEQEEQLGEMIQAYEKLCVEKSDLETELREMRALVETHLRQICGLEQQLRQQQGLQDAAF
SNLSPPPAPAPPCTDLDLHYLALRGGSGLSHAGWPGSTPSVSDLERRRLEEALEAAQGEA
RGAQLREEQLQAECERLQGELKQLQETRAQDLASNQSERDMAWVKRVGDDQVNLALAYTE
LTEELGRLRELSSLQGRILRTLLQEQARSGGQRHSPLSQRHSPAPQCPSPSPPARAAPPC
PPCQSPVPQRRSPVPPCPSPQQRRSPASPSCPSPVPQRRSPVPPSCQSPSPQRRSPVPPS
CPAPQPRPPPPPPPGERTLAERAYAKPPSHHVKAGFQGRRSYSELAEGAAYAGASPPWLQ
AEAATLPKPRAYGSELYGPGRPLSPRRAFEGIRLRFEKQPSEEDEWAVPTSPPSPEVGTI
RCASFCAGFPIPESPAATAYAHAEHAQSWPSINLLMETVGSDIRSCPLCQLGFPVGYPDD
ALIKHIDSHLENSKI
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagtccatgttcgaggacgacatcagcatcctgacgcaggaggccctggggcctagt
gaggtgtggctggacagtcccggagacccctcgcttgggggcgacatgtgctccgcctcc
cactttgccctcatcactgcttacggagacatcaaggaacggctggggggcctggagagg
gagaacgccaccctccgacgccgcctcaaagtctacgagatcaagtacccactgatcagt
gactttggagaggagcatggcttttctctgtatgaaatcaaggatggctccctgctggag
gtggagaaggtcagcctgcagcaacggctcaaccagttccagcatgagttacagaagaac
aaggagcaggaagaacagcttggagagatgatccaggcctacgagaaactctgcgtggag
aagagtgacttggagacagagctgagggagatgagggccctggtggagacgcacctgcgt
cagatctgtggtttggagcagcagctgcggcaacagcaaggcctccaggatgcagccttc
tccaacctgagcccaccgccagcccccgcccctccctgcactgatttagacctgcactac
ctggcactgagagggggatctggcttgagtcatgcaggctggccgggctccacacccagt
gtgagtgacctggagcggcggcggctagaagaggctttggaggccgcgcagggagaggcc
cggggggctcagctccgggaggagcagctccaggccgagtgcgagcggctgcagggggag
ctgaagcagctgcaggagacccgggcccaggatctggcctccaaccagtcggagcgagac
atggcgtgggtgaaaagagttggggatgatcaggtgaatttggcgctggcctacaccgag
ctgacggaggagctgggccggcttcgggagttgagttccctacaggggagaatcttgagg
actctgttgcaggaacaggcccggagtggcggccagaggcactcgccgctgtcacaacgc
cactccccggccccccagtgcccctccccctccccgcctgcccgagcggctcccccgtgc
cccccgtgccagtcccccgtcccccagcgccgctctcccgtgcccccgtgcccctcgccg
cagcagcgccgctctccggcctcaccctcctgcccgtcgcccgtcccgcagcgccgctcg
ccggtgccgccgtcgtgccagtcccccagcccgcagcgccgttccccggtgccccccagc
tgcccggccccgcagccccggccaccgccgccgcccccgccgggcgagaggacgctggcc
gagcgcgcctacgccaagccgcccagccaccacgtgaaggccggcttccagggccgccgc
agctactctgagctggcggagggcgcggcctacgcgggcgcctccccgccctggctgcag
gccgaagcggccactctccccaagccccgggcctacggcagcgagctctacggccctggc
aggcccctcagcccgcggcgcgccttcgagggcatccggctgcgcttcgagaagcagccg
tcggaggaggacgagtgggctgtgcccaccagcccgcccagcccggaggtgggcaccatc
cgctgcgcctccttctgcgcgggcttccccatccccgagtcgcccgccgccaccgcctac
gcccacgccgagcacgcgcagtcctggccgtccatcaacttgctgatggagacggtgggc
tccgacatccgcagctgccccctctgccagctgggtttccctgtcgggtacccggatgat
gccctcatcaaacacattgactcccacctggagaacagcaagatctag

DBGET integrated database retrieval system