KEGG   Homo sapiens (human): 10094
Entry
10094             CDS       T01001                                 

Symbol
ARPC3, ARC21, p21-Arc
Name
(RefSeq) actin related protein 2/3 complex subunit 3
  KO
K05756  actin related protein 2/3 complex, subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04530  Tight junction
hsa04666  Fc gamma R-mediated phagocytosis
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01078  EGF-EGFR-Actin signaling pathway
N01079  Shigella IpaC to Actin signaling pathway
N01086  Escherichia EspT to RAC signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01094  Escherichia Eae/Tir/TccP to Actin signaling pathway
N01096  Escherichia Map to CDC42 signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    10094 (ARPC3)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    10094 (ARPC3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    10094 (ARPC3)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    10094 (ARPC3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10094 (ARPC3)
   05132 Salmonella infection
    10094 (ARPC3)
   05131 Shigellosis
    10094 (ARPC3)
   05135 Yersinia infection
    10094 (ARPC3)
   05100 Bacterial invasion of epithelial cells
    10094 (ARPC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    10094 (ARPC3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    10094 (ARPC3)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Arp2/3 complex
    10094 (ARPC3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Arp2/3 complex
     10094 (ARPC3)
SSDB
Motif
Pfam: P21-Arc
Other DBs
NCBI-GeneID: 10094
NCBI-ProteinID: NP_001265485
OMIM: 604225
HGNC: 706
Ensembl: ENSG00000111229
Vega: OTTHUMG00000134333
Pharos: O15145(Tbio)
UniProt: O15145
LinkDB
Position
12q24.11
AA seq 178 aa
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFKANVFFKNYEI
KNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
ANKQEDEVMRAYLQQLRQETGLRLCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
NT seq 537 nt   +upstreamnt  +downstreamnt
atgccggcttaccactcttctctcatggatcctgataccaaactcatcggaaacatggca
ctgttgcctatcagaagtcaattcaaaggacctgcccccagagagacaaaagatacagat
attgtggatgaagccatctattacttcaaggccaatgtcttcttcaaaaactatgaaatt
aagaatgaagctgataggaccttgatatatataactctctacatttctgaatgtctgaag
aaactgcaaaagtgcaattccaaaagccaaggtgagaaagaaatgtatacgctgggaatc
actaattttcccattcctggagagcctggttttccacttaacgcaatttatgccaaacct
gcaaacaaacaggaagatgaagtgatgagagcctatttacaacagctaaggcaagagact
ggactgagactttgtgagaaagttttcgaccctcagaatgataaacccagcaagtggtgg
acttgctttgtgaagagacagttcatgaacaagagtctttcaggacctggacagtga

DBGET integrated database retrieval system