KEGG   Homo sapiens (human): 10975
Entry
10975             CDS       T01001                                 
Symbol
UQCR11, 0710008D09Rik, QCR10, UQCR
Name
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
N01395  Cadmium to electron transfer in complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10975 (UQCR11)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    10975 (UQCR11)
  09159 Environmental adaptation
   04714 Thermogenesis
    10975 (UQCR11)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    10975 (UQCR11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10975 (UQCR11)
   05012 Parkinson disease
    10975 (UQCR11)
   05014 Amyotrophic lateral sclerosis
    10975 (UQCR11)
   05016 Huntington disease
    10975 (UQCR11)
   05020 Prion disease
    10975 (UQCR11)
   05022 Pathways of neurodegeneration - multiple diseases
    10975 (UQCR11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    10975 (UQCR11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    10975 (UQCR11)
SSDB
Motif
Pfam: UCR_6-4kD QCR10
Other DBs
NCBI-GeneID: 10975
NCBI-ProteinID: NP_006821
OMIM: 609711
HGNC: 30862
Ensembl: ENSG00000127540
Pharos: O14957(Tdark)
UniProt: O14957
Structure
LinkDB
Position
19:complement(1597169..1605462)
AA seq 56 aa
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
NT seq 171 nt   +upstreamnt  +downstreamnt
atggtgacccggttcctgggcccacgctaccgggagctggtcaagaactgggtcccgacg
gcctacacatggggcgctgtgggcgccgtggggctggtgtgggccaccgattggcggctg
atcctggactgggtaccttacatcaatggcaagtttaagaaggataattaa

KEGG   Homo sapiens (human): 125965
Entry
125965            CDS       T01001                                 
Symbol
COX6B2, COXVIB2, CT59
Name
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    125965 (COX6B2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    125965 (COX6B2)
  09159 Environmental adaptation
   04714 Thermogenesis
    125965 (COX6B2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    125965 (COX6B2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125965 (COX6B2)
   05012 Parkinson disease
    125965 (COX6B2)
   05014 Amyotrophic lateral sclerosis
    125965 (COX6B2)
   05016 Huntington disease
    125965 (COX6B2)
   05020 Prion disease
    125965 (COX6B2)
   05022 Pathways of neurodegeneration - multiple diseases
    125965 (COX6B2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    125965 (COX6B2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    125965 (COX6B2)
SSDB
Motif
Pfam: COX6B CX9C 7tm_7
Other DBs
NCBI-GeneID: 125965
NCBI-ProteinID: NP_653214
OMIM: 618127
HGNC: 24380
Ensembl: ENSG00000160471
Pharos: Q6YFQ2(Tdark)
UniProt: Q6YFQ2
LinkDB
Position
19:complement(55349704..55354719)
AA seq 88 aa
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYF
RVYHSLCPISWVESWNEQIKNGIFAGKI
NT seq 267 nt   +upstreamnt  +downstreamnt
atgttggatgtggaagcccaggagccccccaaggggaaatggtcgacgccgcccttcgac
ccgcgcttccccagccagaaccagatccgtaactgctaccagaacttcctggactaccac
cgctgcctcaagaccaggacccgccgcgggaagagcacgcagccctgcgagtactatttc
cgcgtgtaccactcgctgtgccccatcagctgggtggagagctggaacgagcagatcaag
aacgggattttcgccggcaaaatctga

KEGG   Homo sapiens (human): 1327
Entry
1327              CDS       T01001                                 
Symbol
COX4I1, COX_IV-1, COX4, COX4-1, COXIV, COXIV-1, MC4DN16
Name
(RefSeq) cytochrome c oxidase subunit 4I1
  KO
K02263  cytochrome c oxidase subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1327 (COX4I1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1327 (COX4I1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1327 (COX4I1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1327 (COX4I1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1327 (COX4I1)
   05012 Parkinson disease
    1327 (COX4I1)
   05014 Amyotrophic lateral sclerosis
    1327 (COX4I1)
   05016 Huntington disease
    1327 (COX4I1)
   05020 Prion disease
    1327 (COX4I1)
   05022 Pathways of neurodegeneration - multiple diseases
    1327 (COX4I1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1327 (COX4I1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1327 (COX4I1)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 1327
NCBI-ProteinID: NP_001305715
OMIM: 123864
HGNC: 2265
Ensembl: ENSG00000131143
Pharos: P13073(Tbio)
UniProt: P13073 Q86WV2
Structure
LinkDB
Position
16:85799695..85807068
AA seq 169 aa
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
QKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggctaccagggtatttagcctagttggcaagcgagcaatttccacctctgtgtgt
gtacgagctcatgaaagtgttgtgaagagcgaagacttttcgctcccagcttatatggat
cggcgtgaccaccccttgccggaggtggcccatgtcaagcacctgtctgccagccagaag
gcattgaaggagaaggagaaggcctcctggagcagcctctccatggatgagaaagtcgag
ttgtatcgcattaagttcaaggagagctttgctgagatgaacaggggctcgaacgagtgg
aagacggttgtgggcggtgccatgttcttcatcggtttcaccgcgctcgttatcatgtgg
cagaagcactatgtgtacggccccctcccgcaaagctttgacaaagagtgggtggccaag
cagaccaagaggatgctggacatgaaggtgaaccccatccagggcttagcctccaagtgg
gactacgaaaagaacgagtggaagaagtga

KEGG   Homo sapiens (human): 1329
Entry
1329              CDS       T01001                                 
Symbol
COX5B, COXVB
Name
(RefSeq) cytochrome c oxidase subunit 5B
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1329 (COX5B)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1329 (COX5B)
  09159 Environmental adaptation
   04714 Thermogenesis
    1329 (COX5B)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1329 (COX5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1329 (COX5B)
   05012 Parkinson disease
    1329 (COX5B)
   05014 Amyotrophic lateral sclerosis
    1329 (COX5B)
   05016 Huntington disease
    1329 (COX5B)
   05020 Prion disease
    1329 (COX5B)
   05022 Pathways of neurodegeneration - multiple diseases
    1329 (COX5B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1329 (COX5B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1329 (COX5B)
SSDB
Motif
Pfam: COX5B
Other DBs
NCBI-GeneID: 1329
NCBI-ProteinID: NP_001853
OMIM: 123866
HGNC: 2269
Ensembl: ENSG00000135940
Pharos: P10606(Tbio)
UniProt: P10606 A0A384NL93
Structure
LinkDB
Position
2:97646062..97648383
AA seq 129 aa
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagctggaacgctggccgcgcaggccctgagggctcgc
ggccccagtggcgcggccgcgatgcgctccatggcatctggaggtggtgttcccactgat
gaagagcaggcgactgggttggagagggagatcatgctggctgcaaagaagggactggac
ccatacaatgtactggccccaaagggagcttcaggcaccagggaagaccctaatttagtc
ccctccatctccaacaagagaatagtaggctgcatctgtgaagaggacaataccagcgtc
gtctggttttggctgcacaaaggcgaggcccagcgatgcccccgctgtggagcccattac
aagctggtgccccagcagctggcacactga

KEGG   Homo sapiens (human): 1337
Entry
1337              CDS       T01001                                 
Symbol
COX6A1, CMTRID, COX6A, COX6AL
Name
(RefSeq) cytochrome c oxidase subunit 6A1
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1337 (COX6A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1337 (COX6A1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1337 (COX6A1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1337 (COX6A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1337 (COX6A1)
   05012 Parkinson disease
    1337 (COX6A1)
   05014 Amyotrophic lateral sclerosis
    1337 (COX6A1)
   05016 Huntington disease
    1337 (COX6A1)
   05020 Prion disease
    1337 (COX6A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1337 (COX6A1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1337 (COX6A1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1337 (COX6A1)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 1337
NCBI-ProteinID: NP_004364
OMIM: 602072
HGNC: 2277
Ensembl: ENSG00000111775
Pharos: P12074(Tbio)
UniProt: P12074 H6SG15
Structure
LinkDB
Position
12:120438113..120440730
AA seq 109 aa
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLK
SHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcggtagttggtgtgtcctcggtttctcggctgctgggtcggtcccgcccacagctg
gggcggcctatgtcgagtggcgcccatggcgaagagggctcagctcgcatgtggaagact
ctcaccttcttcgtcgcgctccccggggtggcagtcagcatgctgaatgtgtacctgaag
tcgcaccacggagagcacgagagacccgagttcatcgcctacccccatctccgcatcagg
accaagccgtttccctggggagatggtaaccatactctattccataaccctcatgtgaat
ccacttccaactggctacgaagatgaataa

KEGG   Homo sapiens (human): 1339
Entry
1339              CDS       T01001                                 
Symbol
COX6A2, COX6AH, COXVIAH, COXVIa-M, MC4DN18
Name
(RefSeq) cytochrome c oxidase subunit 6A2
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1339 (COX6A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1339 (COX6A2)
  09159 Environmental adaptation
   04714 Thermogenesis
    1339 (COX6A2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1339 (COX6A2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1339 (COX6A2)
   05012 Parkinson disease
    1339 (COX6A2)
   05014 Amyotrophic lateral sclerosis
    1339 (COX6A2)
   05016 Huntington disease
    1339 (COX6A2)
   05020 Prion disease
    1339 (COX6A2)
   05022 Pathways of neurodegeneration - multiple diseases
    1339 (COX6A2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1339 (COX6A2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1339 (COX6A2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 1339
NCBI-ProteinID: NP_005196
OMIM: 602009
HGNC: 2279
Ensembl: ENSG00000156885
Pharos: Q02221(Tbio)
UniProt: Q02221
LinkDB
Position
16:complement(31427731..31428360)
AA seq 97 aa
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctttgcctctgaggcccctgacccggggcttggccagcgctgccaaaggaggccac
ggaggagcaggagctcgtacctggcgtctgctgaccttcgtgctggcgctgcccagcgtg
gccctctgcaccttcaactcctatctccactcgggccaccgcccgcgccccgagttccgt
ccctaccaacacctccgcatccgcaccaagccctacccctggggggacggcaaccacact
ctgttccacaatagccacgtgaaccctctgcccacgggctacgaacacccctga

KEGG   Homo sapiens (human): 1340
Entry
1340              CDS       T01001                                 
Symbol
COX6B1, COX6B, COXG, COXVIb1, MC4DN7
Name
(RefSeq) cytochrome c oxidase subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1340 (COX6B1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1340 (COX6B1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1340 (COX6B1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1340 (COX6B1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1340 (COX6B1)
   05012 Parkinson disease
    1340 (COX6B1)
   05014 Amyotrophic lateral sclerosis
    1340 (COX6B1)
   05016 Huntington disease
    1340 (COX6B1)
   05020 Prion disease
    1340 (COX6B1)
   05022 Pathways of neurodegeneration - multiple diseases
    1340 (COX6B1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1340 (COX6B1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1340 (COX6B1)
SSDB
Motif
Pfam: COX6B CHCH YozE_SAM_like
Other DBs
NCBI-GeneID: 1340
NCBI-ProteinID: NP_001854
OMIM: 124089
HGNC: 2280
Ensembl: ENSG00000126267
Pharos: P14854(Tbio)
UniProt: P14854
Structure
LinkDB
Position
19:35648323..35658782
AA seq 86 aa
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
YQSLCPTSWVTDWDEQRAEGTFPGKI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcggaagacatggagaccaaaatcaagaactacaagaccgccccttttgacagccgc
ttccccaaccagaaccagactagaaactgctggcagaactacctggacttccaccgctgt
cagaaggcaatgaccgctaaaggaggcgatatctctgtgtgcgaatggtaccagcgtgtg
taccagtccctctgccccacatcctgggtcacagactgggatgagcaacgggctgaaggc
acgtttcccgggaagatctga

KEGG   Homo sapiens (human): 1345
Entry
1345              CDS       T01001                                 
Symbol
COX6C
Name
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1345 (COX6C)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1345 (COX6C)
  09159 Environmental adaptation
   04714 Thermogenesis
    1345 (COX6C)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1345 (COX6C)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1345 (COX6C)
   05012 Parkinson disease
    1345 (COX6C)
   05014 Amyotrophic lateral sclerosis
    1345 (COX6C)
   05016 Huntington disease
    1345 (COX6C)
   05020 Prion disease
    1345 (COX6C)
   05022 Pathways of neurodegeneration - multiple diseases
    1345 (COX6C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1345 (COX6C)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1345 (COX6C)
SSDB
Motif
Pfam: COX6C
Other DBs
NCBI-GeneID: 1345
NCBI-ProteinID: NP_004365
OMIM: 124090
HGNC: 2285
Ensembl: ENSG00000164919
Pharos: P09669(Tbio)
UniProt: P09669 A0A024R9B7
Structure
LinkDB
Position
8:complement(99877865..99893707)
AA seq 75 aa
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK
NT seq 228 nt   +upstreamnt  +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa

KEGG   Homo sapiens (human): 1346
Entry
1346              CDS       T01001                                 
Symbol
COX7A1, COX7A, COX7AH, COX7AM
Name
(RefSeq) cytochrome c oxidase subunit 7A1
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1346 (COX7A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1346 (COX7A1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1346 (COX7A1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1346 (COX7A1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1346 (COX7A1)
   05012 Parkinson disease
    1346 (COX7A1)
   05014 Amyotrophic lateral sclerosis
    1346 (COX7A1)
   05016 Huntington disease
    1346 (COX7A1)
   05020 Prion disease
    1346 (COX7A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1346 (COX7A1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1346 (COX7A1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1346 (COX7A1)
SSDB
Motif
Pfam: COX7a COX14
Other DBs
NCBI-GeneID: 1346
NCBI-ProteinID: NP_001855
OMIM: 123995
HGNC: 2287
Ensembl: ENSG00000161281
Pharos: P24310(Tbio)
UniProt: P24310 Q6FGI7
LinkDB
Position
19:complement(36150922..36152447)
AA seq 79 aa
MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC
LGGTVYSLYSLGWASFPRN
NT seq 240 nt   +upstreamnt  +downstreamnt
atgcaggcccttcgggtgtcccaggcgctgatccgctccttcagctccaccgcccggaac
cgctttcagaaccgagtgcgcgagaaacagaagctcttccaggaggacaatgacatcccg
ttgtacctgaagggcggcatcgttgacaacatcctgtaccgagtgacaatgacgctgtgt
ctgggcggcactgtctacagcttgtactcccttggctgggcctccttccccaggaattaa

KEGG   Homo sapiens (human): 1347
Entry
1347              CDS       T01001                                 
Symbol
COX7A2, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL
Name
(RefSeq) cytochrome c oxidase subunit 7A2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1347 (COX7A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1347 (COX7A2)
  09159 Environmental adaptation
   04714 Thermogenesis
    1347 (COX7A2)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1347 (COX7A2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1347 (COX7A2)
   05012 Parkinson disease
    1347 (COX7A2)
   05014 Amyotrophic lateral sclerosis
    1347 (COX7A2)
   05016 Huntington disease
    1347 (COX7A2)
   05020 Prion disease
    1347 (COX7A2)
   05022 Pathways of neurodegeneration - multiple diseases
    1347 (COX7A2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1347 (COX7A2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1347 (COX7A2)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 1347
NCBI-ProteinID: NP_001856
OMIM: 123996
HGNC: 2288
Ensembl: ENSG00000112695
Pharos: P14406(Tdark)
UniProt: P14406 H0UI06
Structure
LinkDB
Position
6:complement(75237675..75250298)
AA seq 83 aa
MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMI
LTVGGTAYAIYELAVASFPKKQE
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctgcggaatctgctggctcttcgtcagattgggcagaggacgataagcactgcttcc
cgcaggcattttaaaaataaagttccggagaagcaaaaactgttccaggaggatgatgaa
attccactgtatctaaagggtggggtagctgatgccctcctgtatagagccaccatgatt
cttacagttggtggaacagcatatgccatatatgagctggctgtggcttcatttcccaag
aagcaggagtga

DBGET integrated database retrieval system