KEGG   Homo sapiens (human): 10975
Entry
10975             CDS       T01001                                 

Gene name
UQCR11, 0710008D09Rik, QCR10, UQCR
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit XI
  KO
K00420  ubiquinol-cytochrome c reductase subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    10975 (UQCR11)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    10975 (UQCR11)
  09159 Environmental adaptation
   04714 Thermogenesis
    10975 (UQCR11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    10975 (UQCR11)
   05012 Parkinson disease
    10975 (UQCR11)
   05014 Amyotrophic lateral sclerosis
    10975 (UQCR11)
   05016 Huntington disease
    10975 (UQCR11)
   05020 Prion disease
    10975 (UQCR11)
   05022 Pathways of neurodegeneration - multiple diseases
    10975 (UQCR11)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    10975 (UQCR11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    10975 (UQCR11)
SSDB
Motif
Pfam: UCR_6-4kD QCR10
Other DBs
NCBI-GeneID: 10975
NCBI-ProteinID: NP_006821
OMIM: 609711
HGNC: 30862
Ensembl: ENSG00000127540
Vega: OTTHUMG00000180084
Pharos: O14957(Tdark)
UniProt: O14957
LinkDB
Structure
PDB: 
5XTE

Position
19p13.3
AA seq 56 aa
MVTRFLGPRYRELVKNWVPTAYTWGAVGAVGLVWATDWRLILDWVPYINGKFKKDN
NT seq 171 nt   +upstreamnt  +downstreamnt
atggtgacccggttcctgggcccacgctaccgggagctggtcaagaactgggtcccgacg
gcctacacatggggcgctgtgggcgccgtggggctggtgtgggccaccgattggcggctg
atcctggactgggtaccttacatcaatggcaagtttaagaaggataattaa

KEGG   Homo sapiens (human): 125965
Entry
125965            CDS       T01001                                 

Gene name
COX6B2, COXVIB2, CT59
Definition
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    125965 (COX6B2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    125965 (COX6B2)
  09159 Environmental adaptation
   04714 Thermogenesis
    125965 (COX6B2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    125965 (COX6B2)
   05012 Parkinson disease
    125965 (COX6B2)
   05014 Amyotrophic lateral sclerosis
    125965 (COX6B2)
   05016 Huntington disease
    125965 (COX6B2)
   05020 Prion disease
    125965 (COX6B2)
   05022 Pathways of neurodegeneration - multiple diseases
    125965 (COX6B2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    125965 (COX6B2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    125965 (COX6B2)
SSDB
Motif
Pfam: COX6B CX9C
Other DBs
NCBI-GeneID: 125965
NCBI-ProteinID: NP_653214
OMIM: 618127
HGNC: 24380
Ensembl: ENSG00000160471
Vega: OTTHUMG00000180774
Pharos: Q6YFQ2(Tdark)
UniProt: Q6YFQ2
LinkDB
Position
19q13.42
AA seq 88 aa
MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYF
RVYHSLCPISWVESWNEQIKNGIFAGKI
NT seq 267 nt   +upstreamnt  +downstreamnt
atgttggatgtggaagcccaggagccccccaaggggaaatggtcgacgccgcccttcgac
ccgcgcttccccagccagaaccagatccgtaactgctaccagaacttcctggactaccac
cgctgcctcaagaccaggacccgccgcgggaagagcacgcagccctgcgagtactatttc
cgcgtgtaccactcgctgtgccccatcagctgggtggagagctggaacgagcagatcaag
aacgggattttcgccggcaaaatctga

KEGG   Homo sapiens (human): 1327
Entry
1327              CDS       T01001                                 

Gene name
COX4I1, COX_IV-1, COX4, COX4-1, COXIV, COXIV-1, MC4DN16
Definition
(RefSeq) cytochrome c oxidase subunit 4I1
  KO
K02263  cytochrome c oxidase subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1327 (COX4I1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1327 (COX4I1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1327 (COX4I1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1327 (COX4I1)
   05012 Parkinson disease
    1327 (COX4I1)
   05014 Amyotrophic lateral sclerosis
    1327 (COX4I1)
   05016 Huntington disease
    1327 (COX4I1)
   05020 Prion disease
    1327 (COX4I1)
   05022 Pathways of neurodegeneration - multiple diseases
    1327 (COX4I1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1327 (COX4I1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1327 (COX4I1)
SSDB
Motif
Pfam: COX4 GAPT
Other DBs
NCBI-GeneID: 1327
NCBI-ProteinID: NP_001305715
OMIM: 123864
HGNC: 2265
Ensembl: ENSG00000131143
Vega: OTTHUMG00000137649
Pharos: P13073(Tbio)
UniProt: P13073 Q86WV2
LinkDB
Structure
PDB: 
5Z62

Position
16q24.1
AA seq 169 aa
MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQK
ALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMW
QKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK
NT seq 510 nt   +upstreamnt  +downstreamnt
atgttggctaccagggtatttagcctagttggcaagcgagcaatttccacctctgtgtgt
gtacgagctcatgaaagtgttgtgaagagcgaagacttttcgctcccagcttatatggat
cggcgtgaccaccccttgccggaggtggcccatgtcaagcacctgtctgccagccagaag
gcattgaaggagaaggagaaggcctcctggagcagcctctccatggatgagaaagtcgag
ttgtatcgcattaagttcaaggagagctttgctgagatgaacaggggctcgaacgagtgg
aagacggttgtgggcggtgccatgttcttcatcggtttcaccgcgctcgttatcatgtgg
cagaagcactatgtgtacggccccctcccgcaaagctttgacaaagagtgggtggccaag
cagaccaagaggatgctggacatgaaggtgaaccccatccagggcttagcctccaagtgg
gactacgaaaagaacgagtggaagaagtga

KEGG   Homo sapiens (human): 1329
Entry
1329              CDS       T01001                                 

Gene name
COX5B, COXVB
Definition
(RefSeq) cytochrome c oxidase subunit 5B
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1329 (COX5B)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1329 (COX5B)
  09159 Environmental adaptation
   04714 Thermogenesis
    1329 (COX5B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1329 (COX5B)
   05012 Parkinson disease
    1329 (COX5B)
   05014 Amyotrophic lateral sclerosis
    1329 (COX5B)
   05016 Huntington disease
    1329 (COX5B)
   05020 Prion disease
    1329 (COX5B)
   05022 Pathways of neurodegeneration - multiple diseases
    1329 (COX5B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1329 (COX5B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1329 (COX5B)
SSDB
Motif
Pfam: COX5B zf-CHCC
Other DBs
NCBI-GeneID: 1329
NCBI-ProteinID: NP_001853
OMIM: 123866
HGNC: 2269
Ensembl: ENSG00000135940
Vega: OTTHUMG00000130548
Pharos: P10606(Tbio)
UniProt: P10606 A0A384NL93
LinkDB
Structure
PDB: 
5Z62

Position
2q11.2
AA seq 129 aa
MASRLLRGAGTLAAQALRARGPSGAAAMRSMASGGGVPTDEEQATGLEREIMLAAKKGLD
PYNVLAPKGASGTREDPNLVPSISNKRIVGCICEEDNTSVVWFWLHKGEAQRCPRCGAHY
KLVPQQLAH
NT seq 390 nt   +upstreamnt  +downstreamnt
atggcttcaaggttacttcgcggagctggaacgctggccgcgcaggccctgagggctcgc
ggccccagtggcgcggccgcgatgcgctccatggcatctggaggtggtgttcccactgat
gaagagcaggcgactgggttggagagggagatcatgctggctgcaaagaagggactggac
ccatacaatgtactggccccaaagggagcttcaggcaccagggaagaccctaatttagtc
ccctccatctccaacaagagaatagtaggctgcatctgtgaagaggacaataccagcgtc
gtctggttttggctgcacaaaggcgaggcccagcgatgcccccgctgtggagcccattac
aagctggtgccccagcagctggcacactga

KEGG   Homo sapiens (human): 1337
Entry
1337              CDS       T01001                                 

Gene name
COX6A1, CMTRID, COX6A, COX6AL
Definition
(RefSeq) cytochrome c oxidase subunit 6A1
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1337 (COX6A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1337 (COX6A1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1337 (COX6A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1337 (COX6A1)
   05012 Parkinson disease
    1337 (COX6A1)
   05014 Amyotrophic lateral sclerosis
    1337 (COX6A1)
   05016 Huntington disease
    1337 (COX6A1)
   05020 Prion disease
    1337 (COX6A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1337 (COX6A1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1337 (COX6A1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1337 (COX6A1)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 1337
NCBI-ProteinID: NP_004364
OMIM: 602072
HGNC: 2277
Ensembl: ENSG00000111775
Vega: OTTHUMG00000047791
Pharos: P12074(Tbio)
UniProt: P12074 H6SG15
LinkDB
Structure
PDB: 
5Z62

Position
12q24.31; 12q24.2
AA seq 109 aa
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLK
SHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcggtagttggtgtgtcctcggtttctcggctgctgggtcggtcccgcccacagctg
gggcggcctatgtcgagtggcgcccatggcgaagagggctcagctcgcatgtggaagact
ctcaccttcttcgtcgcgctccccggggtggcagtcagcatgctgaatgtgtacctgaag
tcgcaccacggagagcacgagagacccgagttcatcgcctacccccatctccgcatcagg
accaagccgtttccctggggagatggtaaccatactctattccataaccctcatgtgaat
ccacttccaactggctacgaagatgaataa

KEGG   Homo sapiens (human): 1339
Entry
1339              CDS       T01001                                 

Gene name
COX6A2, COX6AH, COXVIAH, MC4DN18
Definition
(RefSeq) cytochrome c oxidase subunit 6A2
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1339 (COX6A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1339 (COX6A2)
  09159 Environmental adaptation
   04714 Thermogenesis
    1339 (COX6A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1339 (COX6A2)
   05012 Parkinson disease
    1339 (COX6A2)
   05014 Amyotrophic lateral sclerosis
    1339 (COX6A2)
   05016 Huntington disease
    1339 (COX6A2)
   05020 Prion disease
    1339 (COX6A2)
   05022 Pathways of neurodegeneration - multiple diseases
    1339 (COX6A2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1339 (COX6A2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1339 (COX6A2)
SSDB
Motif
Pfam: COX6A
Other DBs
NCBI-GeneID: 1339
NCBI-ProteinID: NP_005196
OMIM: 602009
HGNC: 2279
Ensembl: ENSG00000156885
Vega: OTTHUMG00000132463
Pharos: Q02221(Tbio)
UniProt: Q02221
LinkDB
Position
16p11.2
AA seq 97 aa
MALPLRPLTRGLASAAKGGHGGAGARTWRLLTFVLALPSVALCTFNSYLHSGHRPRPEFR
PYQHLRIRTKPYPWGDGNHTLFHNSHVNPLPTGYEHP
NT seq 294 nt   +upstreamnt  +downstreamnt
atggctttgcctctgaggcccctgacccggggcttggccagcgctgccaaaggaggccac
ggaggagcaggagctcgtacctggcgtctgctgaccttcgtgctggcgctgcccagcgtg
gccctctgcaccttcaactcctatctccactcgggccaccgcccgcgccccgagttccgt
ccctaccaacacctccgcatccgcaccaagccctacccctggggggacggcaaccacact
ctgttccacaatagccacgtgaaccctctgcccacgggctacgaacacccctga

KEGG   Homo sapiens (human): 1340
Entry
1340              CDS       T01001                                 

Gene name
COX6B1, COX6B, COXG, COXVIb1, MC4DN7
Definition
(RefSeq) cytochrome c oxidase subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1340 (COX6B1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1340 (COX6B1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1340 (COX6B1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1340 (COX6B1)
   05012 Parkinson disease
    1340 (COX6B1)
   05014 Amyotrophic lateral sclerosis
    1340 (COX6B1)
   05016 Huntington disease
    1340 (COX6B1)
   05020 Prion disease
    1340 (COX6B1)
   05022 Pathways of neurodegeneration - multiple diseases
    1340 (COX6B1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1340 (COX6B1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1340 (COX6B1)
SSDB
Motif
Pfam: COX6B
Other DBs
NCBI-GeneID: 1340
NCBI-ProteinID: NP_001854
OMIM: 124089
HGNC: 2280
Ensembl: ENSG00000126267
Vega: OTTHUMG00000048112
Pharos: P14854(Tbio)
UniProt: P14854
LinkDB
Structure
PDB: 
5Z62

Position
19q13.12
AA seq 86 aa
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
YQSLCPTSWVTDWDEQRAEGTFPGKI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcggaagacatggagaccaaaatcaagaactacaagaccgccccttttgacagccgc
ttccccaaccagaaccagactagaaactgctggcagaactacctggacttccaccgctgt
cagaaggcaatgaccgctaaaggaggcgatatctctgtgtgcgaatggtaccagcgtgtg
taccagtccctctgccccacatcctgggtcacagactgggatgagcaacgggctgaaggc
acgtttcccgggaagatctga

KEGG   Homo sapiens (human): 1345
Entry
1345              CDS       T01001                                 

Gene name
COX6C
Definition
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1345 (COX6C)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1345 (COX6C)
  09159 Environmental adaptation
   04714 Thermogenesis
    1345 (COX6C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1345 (COX6C)
   05012 Parkinson disease
    1345 (COX6C)
   05014 Amyotrophic lateral sclerosis
    1345 (COX6C)
   05016 Huntington disease
    1345 (COX6C)
   05020 Prion disease
    1345 (COX6C)
   05022 Pathways of neurodegeneration - multiple diseases
    1345 (COX6C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1345 (COX6C)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1345 (COX6C)
SSDB
Motif
Pfam: COX6C
Other DBs
NCBI-GeneID: 1345
NCBI-ProteinID: NP_004365
OMIM: 124090
HGNC: 2285
Ensembl: ENSG00000164919
Vega: OTTHUMG00000164703
Pharos: P09669(Tbio)
UniProt: P09669 A0A024R9B7
LinkDB
Structure
PDB: 
5Z62

Position
8q22.2
AA seq 75 aa
MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMK
DFEEMRKAGIFQSVK
NT seq 228 nt   +upstreamnt  +downstreamnt
atggctcccgaagttttgccaaaacctcggatgcgtggccttctggccaggcgtctgcga
aatcatatggctgtagcattcgtgctatccctgggggttgcagctttgtataagtttcgt
gtggctgatcaaagaaagaaggcatacgcagatttctacagaaactacgatgtcatgaaa
gattttgaggagatgaggaaggctggtatctttcagagtgtaaagtaa

KEGG   Homo sapiens (human): 1346
Entry
1346              CDS       T01001                                 

Gene name
COX7A1, COX7A, COX7AH, COX7AM
Definition
(RefSeq) cytochrome c oxidase subunit 7A1
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1346 (COX7A1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1346 (COX7A1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1346 (COX7A1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1346 (COX7A1)
   05012 Parkinson disease
    1346 (COX7A1)
   05014 Amyotrophic lateral sclerosis
    1346 (COX7A1)
   05016 Huntington disease
    1346 (COX7A1)
   05020 Prion disease
    1346 (COX7A1)
   05022 Pathways of neurodegeneration - multiple diseases
    1346 (COX7A1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1346 (COX7A1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1346 (COX7A1)
SSDB
Motif
Pfam: COX7a COX14
Other DBs
NCBI-GeneID: 1346
NCBI-ProteinID: NP_001855
OMIM: 123995
HGNC: 2287
Ensembl: ENSG00000161281
Vega: OTTHUMG00000048144
Pharos: P24310(Tbio)
UniProt: P24310 Q6FGI7
LinkDB
Position
19q13.12
AA seq 79 aa
MQALRVSQALIRSFSSTARNRFQNRVREKQKLFQEDNDIPLYLKGGIVDNILYRVTMTLC
LGGTVYSLYSLGWASFPRN
NT seq 240 nt   +upstreamnt  +downstreamnt
atgcaggcccttcgggtgtcccaggcgctgatccgctccttcagctccaccgcccggaac
cgctttcagaaccgagtgcgcgagaaacagaagctcttccaggaggacaatgacatcccg
ttgtacctgaagggcggcatcgttgacaacatcctgtaccgagtgacaatgacgctgtgt
ctgggcggcactgtctacagcttgtactcccttggctgggcctccttccccaggaattaa

KEGG   Homo sapiens (human): 1347
Entry
1347              CDS       T01001                                 

Gene name
COX7A2, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL
Definition
(RefSeq) cytochrome c oxidase subunit 7A2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1347 (COX7A2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1347 (COX7A2)
  09159 Environmental adaptation
   04714 Thermogenesis
    1347 (COX7A2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1347 (COX7A2)
   05012 Parkinson disease
    1347 (COX7A2)
   05014 Amyotrophic lateral sclerosis
    1347 (COX7A2)
   05016 Huntington disease
    1347 (COX7A2)
   05020 Prion disease
    1347 (COX7A2)
   05022 Pathways of neurodegeneration - multiple diseases
    1347 (COX7A2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1347 (COX7A2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1347 (COX7A2)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 1347
NCBI-ProteinID: NP_001856
OMIM: 123996
HGNC: 2288
Ensembl: ENSG00000112695
Vega: OTTHUMG00000015049
Pharos: P14406(Tdark)
UniProt: P14406 H0UI06
LinkDB
Structure
PDB: 
5Z62

Position
6q14.1
AA seq 83 aa
MLRNLLALRQIGQRTISTASRRHFKNKVPEKQKLFQEDDEIPLYLKGGVADALLYRATMI
LTVGGTAYAIYELAVASFPKKQE
NT seq 252 nt   +upstreamnt  +downstreamnt
atgctgcggaatctgctggctcttcgtcagattgggcagaggacgataagcactgcttcc
cgcaggcattttaaaaataaagttccggagaagcaaaaactgttccaggaggatgatgaa
attccactgtatctaaagggtggggtagctgatgccctcctgtatagagccaccatgatt
cttacagttggtggaacagcatatgccatatatgagctggctgtggcttcatttcccaag
aagcaggagtga

KEGG   Homo sapiens (human): 1349
Entry
1349              CDS       T01001                                 

Gene name
COX7B, APLCC, LSDMCA2
Definition
(RefSeq) cytochrome c oxidase subunit 7B
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H01904  Microphthalmia with linear skin defects syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1349 (COX7B)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1349 (COX7B)
  09159 Environmental adaptation
   04714 Thermogenesis
    1349 (COX7B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1349 (COX7B)
   05012 Parkinson disease
    1349 (COX7B)
   05014 Amyotrophic lateral sclerosis
    1349 (COX7B)
   05016 Huntington disease
    1349 (COX7B)
   05020 Prion disease
    1349 (COX7B)
   05022 Pathways of neurodegeneration - multiple diseases
    1349 (COX7B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1349 (COX7B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1349 (COX7B)
SSDB
Motif
Pfam: COX7B Deltameth_res
Other DBs
NCBI-GeneID: 1349
NCBI-ProteinID: NP_001857
OMIM: 300885
HGNC: 2291
Ensembl: ENSG00000131174
Vega: OTTHUMG00000022718
Pharos: P24311(Tbio)
UniProt: P24311
LinkDB
Structure
PDB: 
5Z62

Position
Xq21.1
AA seq 80 aa
MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQV
GIEWNLSPVGRVTPKEWRNQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgtttcccttggtcaaaagcgcactaaatcgtctccaagttcgaagcattcagcaaaca
atggcaaggcagagccaccagaaacgtacacctgattttcatgacaaatacggtaatgct
gtattagctagtggagccactttctgtattgttacatggacatatgtagcaacacaagtc
ggaatagaatggaacctgtcccctgttggcagagttaccccaaaggaatggaggaatcag
taa

KEGG   Homo sapiens (human): 1350
Entry
1350              CDS       T01001                                 

Gene name
COX7C
Definition
(RefSeq) cytochrome c oxidase subunit 7C
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1350 (COX7C)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1350 (COX7C)
  09159 Environmental adaptation
   04714 Thermogenesis
    1350 (COX7C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1350 (COX7C)
   05012 Parkinson disease
    1350 (COX7C)
   05014 Amyotrophic lateral sclerosis
    1350 (COX7C)
   05016 Huntington disease
    1350 (COX7C)
   05020 Prion disease
    1350 (COX7C)
   05022 Pathways of neurodegeneration - multiple diseases
    1350 (COX7C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1350 (COX7C)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1350 (COX7C)
SSDB
Motif
Pfam: COX7C
Other DBs
NCBI-GeneID: 1350
NCBI-ProteinID: NP_001858
OMIM: 603774
HGNC: 2292
Ensembl: ENSG00000127184
Vega: OTTHUMG00000119049
Pharos: P15954(Tdark)
UniProt: P15954
LinkDB
Structure
PDB: 
5Z62

Position
5q14.3
AA seq 63 aa
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT
NT seq 192 nt   +upstreamnt  +downstreamnt
atgttgggccagagcatccggaggttcacaacctctgtggtccgtaggagccactatgag
gagggccctgggaagaatttgccattttcagtggaaaacaagtggtcgttactagctaag
atgtgtttgtactttggatctgcatttgctacacccttccttgtagtaagacaccaactg
cttaaaacataa

KEGG   Homo sapiens (human): 1351
Entry
1351              CDS       T01001                                 

Gene name
COX8A, COX, COX8, COX8-2, COX8L, MC4DN15, VIII, VIII-L
Definition
(RefSeq) cytochrome c oxidase subunit 8A
  KO
K02273  cytochrome c oxidase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1351 (COX8A)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1351 (COX8A)
  09159 Environmental adaptation
   04714 Thermogenesis
    1351 (COX8A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1351 (COX8A)
   05012 Parkinson disease
    1351 (COX8A)
   05014 Amyotrophic lateral sclerosis
    1351 (COX8A)
   05016 Huntington disease
    1351 (COX8A)
   05020 Prion disease
    1351 (COX8A)
   05022 Pathways of neurodegeneration - multiple diseases
    1351 (COX8A)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1351 (COX8A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1351 (COX8A)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 1351
NCBI-ProteinID: NP_004065
OMIM: 123870
HGNC: 2294
Ensembl: ENSG00000176340
Vega: OTTHUMG00000167785
Pharos: P10176(Tbio)
UniProt: P10176 Q53XN1
LinkDB
Structure
PDB: 
5Z62

Position
11q13.1
AA seq 69 aa
MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILS
HLETYRRPE
NT seq 210 nt   +upstreamnt  +downstreamnt
atgtccgtcctgacgccgctgctgctgcggggcttgacaggctcggcccggcggctccca
gtgccgcgcgccaagatccattcgttgccgccggaggggaagcttgggatcatggaattg
gccgttgggcttacctcctgcttcgtgaccttcctcctgccagcgggctggatcctgtca
cacctggagacctacaggaggccagagtga

KEGG   Homo sapiens (human): 1537
Entry
1537              CDS       T01001                                 

Gene name
CYC1, MC3DN6, UQCR4
Definition
(RefSeq) cytochrome c1
  KO
K00413  ubiquinol-cytochrome c reductase cytochrome c1 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1537 (CYC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1537 (CYC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1537 (CYC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1537 (CYC1)
   05012 Parkinson disease
    1537 (CYC1)
   05014 Amyotrophic lateral sclerosis
    1537 (CYC1)
   05016 Huntington disease
    1537 (CYC1)
   05020 Prion disease
    1537 (CYC1)
   05022 Pathways of neurodegeneration - multiple diseases
    1537 (CYC1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1537 (CYC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1537 (CYC1)
SSDB
Motif
Pfam: Cytochrom_C1 Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-GeneID: 1537
NCBI-ProteinID: NP_001907
OMIM: 123980
HGNC: 2579
Ensembl: ENSG00000179091
Vega: OTTHUMG00000165242
Pharos: P08574(Tbio)
UniProt: P08574
LinkDB
Structure
PDB: 
5XTE

Position
8q24.3
AA seq 325 aa
MAAAAASLRGVVLGPRGAGLPGARARGLLCSARPGQLPLRTPQAVALSSKSGLSRGRKVM
LSALGMLAAGGAGLAMALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQV
CASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYP
NSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQ
AIAMAPPIYTDVLEFDDGTPATMSQIAKDVCTFLRWASEPEHDHRKRMGLKMLMMMALLV
PLVYTIKRHKWSVLKSRKLAYRPPK
NT seq 978 nt   +upstreamnt  +downstreamnt
atggcggcagctgcggcttcgcttcgcggggtagtgttgggcccgcggggcgcggggctc
ccgggcgcgcgtgcccggggtctgctgtgcagcgcgcgtcccgggcagctcccgctacgg
acacctcaggcagtggccttgtcgtcgaagtctggcctttcccgaggccggaaagtgatg
ctgtcagcgctgggcatgctggcggcagggggtgcggggctggccatggctctgcattcg
gctgtgagtgccagtgacctggagctgcacccccccagctatccgtggtctcaccgtggc
ctcctctcttccttggaccacaccagcatccggaggggtttccaggtatataagcaggtg
tgcgcctcctgccacagcatggacttcgtggcctaccgccacctggtgggcgtgtgctac
acggaggatgaagctaaggagctggctgcggaggtggaggttcaagacggccccaatgaa
gatggggagatgttcatgcggccagggaagctgttcgactatttcccaaaaccatacccc
aacagtgaggctgctcgagctgccaacaacggagcattgccccctgacctcagctacatc
gtgcgagctaggcatggtggtgaggactacgtcttctccctgctcacgggctactgcgag
ccacccaccggggtgtcactgcgggaaggtctctacttcaacccctactttcctggccag
gccattgccatggcccctcccatctacacagatgtcttagagtttgacgatggcacccca
gctaccatgtcccagatagccaaggatgtgtgcaccttcctgcgctgggcatctgagcca
gagcacgaccatcgaaaacgcatggggctcaagatgttgatgatgatggctctgctggtg
cccctggtctacaccataaagcggcacaagtggtcagtcctgaagagtcggaagctggca
tatcggccgcccaagtga

KEGG   Homo sapiens (human): 170712
Entry
170712            CDS       T01001                                 

Gene name
COX7B2
Definition
(RefSeq) cytochrome c oxidase subunit 7B2
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    170712 (COX7B2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    170712 (COX7B2)
  09159 Environmental adaptation
   04714 Thermogenesis
    170712 (COX7B2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    170712 (COX7B2)
   05012 Parkinson disease
    170712 (COX7B2)
   05014 Amyotrophic lateral sclerosis
    170712 (COX7B2)
   05016 Huntington disease
    170712 (COX7B2)
   05020 Prion disease
    170712 (COX7B2)
   05022 Pathways of neurodegeneration - multiple diseases
    170712 (COX7B2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    170712 (COX7B2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    170712 (COX7B2)
SSDB
Motif
Pfam: COX7B Deltameth_res
Other DBs
NCBI-GeneID: 170712
NCBI-ProteinID: NP_570972
OMIM: 609811
HGNC: 24381
Ensembl: ENSG00000170516
Vega: OTTHUMG00000099423
Pharos: Q8TF08(Tdark)
UniProt: Q8TF08
LinkDB
Position
4p12
AA seq 81 aa
MMFPLARNALSSLKIQSILQSMARHSHVKHSPDFHDKYGNAVLASGTAFCVATWVFTATQ
IGIEWNLSPVGRVTPKEWKHQ
NT seq 246 nt   +upstreamnt  +downstreamnt
atgatgtttcccttggccagaaatgcactaagcagtctcaagattcaaagcattctgcaa
agcatggcaagacatagccatgtaaaacactcaccagattttcatgataaatatggtaat
gctgtgctagccagtggaactgctttctgtgttgctacatgggtgtttacagccactcag
attggaatagaatggaacctatcccctgttggcagagttaccccaaaagagtggaaacat
cagtaa

KEGG   Homo sapiens (human): 27089
Entry
27089             CDS       T01001                                 

Gene name
UQCRQ, MC3DN4, QCR8, QP-C, QPC, UQCR7
Definition
(RefSeq) ubiquinol-cytochrome c reductase complex III subunit VII
  KO
K00418  ubiquinol-cytochrome c reductase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    27089 (UQCRQ)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    27089 (UQCRQ)
  09159 Environmental adaptation
   04714 Thermogenesis
    27089 (UQCRQ)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    27089 (UQCRQ)
   05012 Parkinson disease
    27089 (UQCRQ)
   05014 Amyotrophic lateral sclerosis
    27089 (UQCRQ)
   05016 Huntington disease
    27089 (UQCRQ)
   05020 Prion disease
    27089 (UQCRQ)
   05022 Pathways of neurodegeneration - multiple diseases
    27089 (UQCRQ)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    27089 (UQCRQ)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    27089 (UQCRQ)
SSDB
Motif
Pfam: UcrQ Cyt_b-c1_8
Other DBs
NCBI-GeneID: 27089
NCBI-ProteinID: NP_055217
OMIM: 612080
HGNC: 29594
Ensembl: ENSG00000164405
Vega: OTTHUMG00000059836
Pharos: O14949(Tbio)
UniProt: O14949
LinkDB
Structure
PDB: 
5XTE

Position
5q31.1
AA seq 82 aa
MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIY
TWGTEEFERSKRKNPAAYENDK
NT seq 249 nt   +upstreamnt  +downstreamnt
atgggccgcgagtttgggaatctgacgcggatgcggcatgtgatcagctacagcttgtca
ccgttcgagcagcgcgcctatccgcacgtcttcactaaaggaatccccaatgttctgcgc
cgcattcgggagtctttctttcgcgtggtgccgcagtttgtagtgttttatcttatctac
acatgggggactgaagagttcgagagatccaagaggaagaatccagctgcctatgaaaat
gacaaatga

KEGG   Homo sapiens (human): 29796
Entry
29796             CDS       T01001                                 

Gene name
UQCR10, HSPC051, HSPC119, HSPC151, QCR9, UCCR7.2, UCRC
Definition
(RefSeq) ubiquinol-cytochrome c reductase, complex III subunit X
  KO
K00419  ubiquinol-cytochrome c reductase subunit 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    29796 (UQCR10)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    29796 (UQCR10)
  09159 Environmental adaptation
   04714 Thermogenesis
    29796 (UQCR10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    29796 (UQCR10)
   05012 Parkinson disease
    29796 (UQCR10)
   05014 Amyotrophic lateral sclerosis
    29796 (UQCR10)
   05016 Huntington disease
    29796 (UQCR10)
   05020 Prion disease
    29796 (UQCR10)
   05022 Pathways of neurodegeneration - multiple diseases
    29796 (UQCR10)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    29796 (UQCR10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    29796 (UQCR10)
SSDB
Motif
Pfam: UCR_UQCRX_QCR9
Other DBs
NCBI-GeneID: 29796
NCBI-ProteinID: NP_037519
OMIM: 610843
HGNC: 30863
Ensembl: ENSG00000184076
Vega: OTTHUMG00000151283
Pharos: Q9UDW1(Tdark)
UniProt: Q9UDW1
LinkDB
Structure
PDB: 
5XTE

Position
22q12.2
AA seq 63 aa
MAAATLTSKLYSLLFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKY
ENK
NT seq 192 nt   +upstreamnt  +downstreamnt
atggcggccgcgacgttgacttcgaaattgtactccctgctgttccgcaggacctccacc
ttcgccctcaccatcatcgtgggcgtcatgttcttcgagcgcgccttcgatcaaggcgcg
gacgctatctacgaccacatcaacgaggggaagctgtggaaacacatcaagcacaagtat
gagaacaagtag

KEGG   Homo sapiens (human): 341947
Entry
341947            CDS       T01001                                 

Gene name
COX8C, COX8-3
Definition
(RefSeq) cytochrome c oxidase subunit 8C
  KO
K02273  cytochrome c oxidase subunit 8
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    341947 (COX8C)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    341947 (COX8C)
  09159 Environmental adaptation
   04714 Thermogenesis
    341947 (COX8C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    341947 (COX8C)
   05012 Parkinson disease
    341947 (COX8C)
   05014 Amyotrophic lateral sclerosis
    341947 (COX8C)
   05016 Huntington disease
    341947 (COX8C)
   05020 Prion disease
    341947 (COX8C)
   05022 Pathways of neurodegeneration - multiple diseases
    341947 (COX8C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    341947 (COX8C)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    341947 (COX8C)
SSDB
Motif
Pfam: COX8
Other DBs
NCBI-GeneID: 341947
NCBI-ProteinID: NP_892016
OMIM: 616855
HGNC: 24382
Ensembl: ENSG00000187581
Vega: OTTHUMG00000171279
Pharos: Q7Z4L0(Tdark)
UniProt: Q7Z4L0
LinkDB
Position
14q32.12
AA seq 72 aa
MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAA
YVLGNLKQFRRN
NT seq 219 nt   +upstreamnt  +downstreamnt
atgcctctcctgcgtgggcgctgtcctgcccgccgccactaccgccgcttggccctgctc
ggcctgcagcccgctccccgcttcgcccactcggggcccccgcgccagcggcccctgtct
gccgcggaaatggctgttggacttgtggtgttttttacgaccttcttaacaccagctgca
tatgtgctaggcaacctgaagcagttcagaaggaattag

KEGG   Homo sapiens (human): 440567
Entry
440567            CDS       T01001                                 

Gene name
UQCRHL, hCG25371
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein like
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    440567 (UQCRHL)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    440567 (UQCRHL)
  09159 Environmental adaptation
   04714 Thermogenesis
    440567 (UQCRHL)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    440567 (UQCRHL)
   05012 Parkinson disease
    440567 (UQCRHL)
   05014 Amyotrophic lateral sclerosis
    440567 (UQCRHL)
   05016 Huntington disease
    440567 (UQCRHL)
   05020 Prion disease
    440567 (UQCRHL)
   05022 Pathways of neurodegeneration - multiple diseases
    440567 (UQCRHL)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    440567 (UQCRHL)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    440567 (UQCRHL)
SSDB
Motif
Pfam: UCR_hinge Syntaxin-6_N
Other DBs
NCBI-GeneID: 440567
NCBI-ProteinID: NP_001083060
HGNC: 51714
Ensembl: ENSG00000233954
Vega: OTTHUMG00000003109
UniProt: A0A096LP55
LinkDB
Position
1p36.21
AA seq 91 aa
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctatgatgagcatgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcaaaggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

KEGG   Homo sapiens (human): 4512
Entry
4512              CDS       T01001                                 

Gene name
COX1, COI, MTCO1, MT-CO1
Definition
(RefSeq) cytochrome c oxidase subunit I
  KO
K02256  cytochrome c oxidase subunit 1 [EC:7.1.1.9]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H00068  Leber hereditary optic atrophy
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4512 (COX1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4512 (COX1)
  09159 Environmental adaptation
   04714 Thermogenesis
    4512 (COX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4512 (COX1)
   05012 Parkinson disease
    4512 (COX1)
   05014 Amyotrophic lateral sclerosis
    4512 (COX1)
   05016 Huntington disease
    4512 (COX1)
   05020 Prion disease
    4512 (COX1)
   05022 Pathways of neurodegeneration - multiple diseases
    4512 (COX1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4512 (COX1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4512 (COX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4512 (COX1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.9  cytochrome-c oxidase
     4512 (COX1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4512 (COX1)
SSDB
Motif
Pfam: COX1
Other DBs
NCBI-GeneID: 4512
NCBI-ProteinID: YP_003024028
OMIM: 516030
HGNC: 7419
Pharos: P00395(Tchem)
UniProt: P00395 U5YWV7 A0A1X7RBG2
LinkDB
Structure
PDB: 
5Z62

Position
MT
AA seq 513 aa
MFADRWLFSTNHKDIGTLYLLFGAWAGVLGTALSLLIRAELGQPGNLLGNDHIYNVIVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSLLLLLASAMVEA
GAGTGWTVYPPLAGNYSHPGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMTQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGSNMKWSAAVLWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFIHWFPLFSGYTLDQTYAKIHFTIMFIG
VNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKR
KVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgttcgccgaccgttgactattctctacaaaccacaaagacattggaacactataccta
ttattcggcgcatgagctggagtcctaggcacagctctaagcctccttattcgagccgag
ctgggccagccaggcaaccttctaggtaacgaccacatctacaacgttatcgtcacagcc
catgcatttgtaataatcttcttcatagtaatacccatcataatcggaggctttggcaac
tgactagttcccctaataatcggtgcccccgatatggcgtttccccgcataaacaacata
agcttctgactcttacctccctctctcctactcctgctcgcatctgctatagtggaggcc
ggagcaggaacaggttgaacagtctaccctcccttagcagggaactactcccaccctgga
gcctccgtagacctaaccatcttctccttacacctagcaggtgtctcctctatcttaggg
gccatcaatttcatcacaacaattatcaatataaaaccccctgccataacccaataccaa
acgcccctcttcgtctgatccgtcctaatcacagcagtcctacttctcctatctctccca
gtcctagctgctggcatcactatactactaacagaccgcaacctcaacaccaccttcttc
gaccccgccggaggaggagaccccattctataccaacacctattctgatttttcggtcac
cctgaagtttatattcttatcctaccaggcttcggaataatctcccatattgtaacttac
tactccggaaaaaaagaaccatttggatacataggtatggtctgagctatgatatcaatt
ggcttcctagggtttatcgtgtgagcacaccatatatttacagtaggaatagacgtagac
acacgagcatatttcacctccgctaccataatcatcgctatccccaccggcgtcaaagta
tttagctgactcgccacactccacggaagcaatatgaaatgatctgctgcagtgctctga
gccctaggattcatctttcttttcaccgtaggtggcctgactggcattgtattagcaaac
tcatcactagacatcgtactacacgacacgtactacgttgtagcccacttccactatgtc
ctatcaataggagctgtatttgccatcataggaggcttcattcactgatttcccctattc
tcaggctacaccctagaccaaacctacgccaaaatccatttcactatcatattcatcggc
gtaaatctaactttcttcccacaacactttctcggcctatccggaatgccccgacgttac
tcggactaccccgatgcatacaccacatgaaacatcctatcatctgtaggctcattcatt
tctctaacagcagtaatattaataattttcatgatttgagaagccttcgcttcgaagcga
aaagtcctaatagtagaagaaccctccataaacctggagtgactatatggatgcccccca
ccctaccacacattcgaagaacccgtatacataaaatctaga

KEGG   Homo sapiens (human): 4513
Entry
4513              CDS       T01001                                 

Gene name
COX2, COII, MTCO2, MT-CO2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4513 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4513 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    4513 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4513 (COX2)
   05012 Parkinson disease
    4513 (COX2)
   05014 Amyotrophic lateral sclerosis
    4513 (COX2)
   05016 Huntington disease
    4513 (COX2)
   05020 Prion disease
    4513 (COX2)
   05022 Pathways of neurodegeneration - multiple diseases
    4513 (COX2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4513 (COX2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4513 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4513 (COX2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4513 (COX2)
SSDB
Motif
Pfam: COX2 COX2_TM DUF3100 DPM3 NPCC
Other DBs
NCBI-GeneID: 4513
NCBI-ProteinID: YP_003024029
OMIM: 516040
HGNC: 7421
Pharos: P00403(Tchem)
UniProt: P00403 U5Z487 A0A1X7RBF7
LinkDB
Structure
PDB: 
5Z62

Position
MT
AA seq 227 aa
MAHAAQVGLQDATSPIMEELITFHDHALMIIFLICFLVLYALFLTLTTKLTNTNISDAQE
METVWTILPAIILVLIALPSLRILYMTDEVNDPSLTIKSIGHQWYWTYEYTDYGGLIFNS
YMLPPLFLEPGDLRLLDVDNRVVLPIEAPIRMMITSQDVLHSWAVPTLGLKTDAIPGRLN
QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
NT seq 684 nt   +upstreamnt  +downstreamnt
atggcacatgcagcgcaagtaggtctacaagacgctacttcccctatcatagaagagctt
atcacctttcatgatcacgccctcataatcattttccttatctgcttcctagtcctgtat
gcccttttcctaacactcacaacaaaactaactaatactaacatctcagacgctcaggaa
atagaaaccgtctgaactatcctgcccgccatcatcctagtcctcatcgccctcccatcc
ctacgcatcctttacataacagacgaggtcaacgatccctcccttaccatcaaatcaatt
ggccaccaatggtactgaacctacgagtacaccgactacggcggactaatcttcaactcc
tacatacttcccccattattcctagaaccaggcgacctgcgactccttgacgttgacaat
cgagtagtactcccgattgaagcccccattcgtataataattacatcacaagacgtcttg
cactcatgagctgtccccacattaggcttaaaaacagatgcaattcccggacgtctaaac
caaaccactttcaccgctacacgaccgggggtatactacggtcaatgctctgaaatctgt
ggagcaaaccacagtttcatgcccatcgtcctagaattaattcccctaaaaatctttgaa
atagggcccgtatttaccctatag

KEGG   Homo sapiens (human): 4514
Entry
4514              CDS       T01001                                 

Gene name
COX3, COIII, MTCO3, MT-CO3
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K02262  cytochrome c oxidase subunit 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H00068  Leber hereditary optic atrophy
H01355  Kearns-Sayre syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4514 (COX3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4514 (COX3)
  09159 Environmental adaptation
   04714 Thermogenesis
    4514 (COX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4514 (COX3)
   05012 Parkinson disease
    4514 (COX3)
   05014 Amyotrophic lateral sclerosis
    4514 (COX3)
   05016 Huntington disease
    4514 (COX3)
   05020 Prion disease
    4514 (COX3)
   05022 Pathways of neurodegeneration - multiple diseases
    4514 (COX3)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4514 (COX3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4514 (COX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4514 (COX3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    4514 (COX3)
SSDB
Motif
Pfam: COX3
Other DBs
NCBI-GeneID: 4514
NCBI-ProteinID: YP_003024032
OMIM: 516050
HGNC: 7422
Pharos: P00414(Tbio)
UniProt: P00414 Q7GIM7 A0A1X7RBF0
LinkDB
Structure
PDB: 
5Z62

Position
MT
AA seq 261 aa
MTHQSHAYHMVKPSPWPLTGALSALLMTSGLAMWFHFHSMTLLMLGLLTNTLTMYQWWRD
VTRESTYQGHHTPPVQKGLRYGMILFITSEVFFFAGFFWAFYHSSLAPTPQLGGHWPPTG
ITPLNPLEVPLLNTSVLLASGVSITWAHHSLMENNRNQMIQALLITILLGLYFTLLQASE
YFESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt   +upstreamnt  +downstreamnt
atgacccaccaatcacatgcctatcatatagtaaaacccagcccatgacccctaacaggg
gccctctcagccctcctaatgacctccggcctagccatgtgatttcacttccactccata
acgctcctcatactaggcctactaaccaacacactaaccatataccaatgatggcgcgat
gtaacacgagaaagcacataccaaggccaccacacaccacctgtccaaaaaggccttcga
tacgggataatcctatttattacctcagaagtttttttcttcgcaggatttttctgagcc
ttttaccactccagcctagcccctaccccccaattaggagggcactggcccccaacaggc
atcaccccgctaaatcccctagaagtcccactcctaaacacatccgtattactcgcatca
ggagtatcaatcacctgagctcaccatagtctaatagaaaacaaccgaaaccaaataatt
caagcactgcttattacaattttactgggtctctattttaccctcctacaagcctcagag
tacttcgagtctcccttcaccatttccgacggcatctacggctcaacattttttgtagcc
acaggcttccacggacttcacgtcattattggctcaactttcctcactatctgcttcatc
cgccaactaatatttcactttacatccaaacatcactttggcttcgaagccgccgcctga
tactggcattttgtagatgtggtttgactatttctgtatgtctccatctattgatgaggg
tctt

KEGG   Homo sapiens (human): 4519
Entry
4519              CDS       T01001                                 

Gene name
CYTB, MTCYB, MT-CYB
Definition
(RefSeq) cytochrome b
  KO
K00412  ubiquinol-cytochrome c reductase cytochrome b subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Disease
H00068  Leber hereditary optic atrophy
H01355  Kearns-Sayre syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4519 (CYTB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4519 (CYTB)
  09159 Environmental adaptation
   04714 Thermogenesis
    4519 (CYTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4519 (CYTB)
   05012 Parkinson disease
    4519 (CYTB)
   05014 Amyotrophic lateral sclerosis
    4519 (CYTB)
   05016 Huntington disease
    4519 (CYTB)
   05020 Prion disease
    4519 (CYTB)
   05022 Pathways of neurodegeneration - multiple diseases
    4519 (CYTB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    4519 (CYTB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4519 (CYTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4519 (CYTB)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex III
    4519 (CYTB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 Cytochrom_B_C
Other DBs
NCBI-GeneID: 4519
NCBI-ProteinID: YP_003024038
OMIM: 516020
HGNC: 7427
Pharos: P00156(Tbio)
UniProt: P00156 Q0ZFD6 Q6VLV1
LinkDB
Structure
PDB: 
5XTE

Position
MT
AA seq 380 aa
MTPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFLAMHYSPDAS
TAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRGLYYGSFLYSETWNIGIILL
LATMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTDLVQWIWGGYSVDSPTLTRFFT
FHFILPFIIAALATLHLLFLHETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLM
TLTLFSPDLLGDPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILI
LAMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIGQVASVLYFT
TILILMPTISLIENKMLKWA
NT seq 1141 nt   +upstreamnt  +downstreamnt
atgaccccaatacgcaaaactaaccccctaataaaattaattaaccactcattcatcgac
ctccccaccccatccaacatctccgcatgatgaaacttcggctcactccttggcgcctgc
ctgatcctccaaatcaccacaggactattcctagccatgcactactcaccagacgcctca
accgccttttcatcaatcgcccacatcactcgagacgtaaattatggctgaatcatccgc
taccttcacgccaatggcgcctcaatattctttatctgcctcttcctacacatcgggcga
ggcctatattacggatcatttctctactcagaaacctgaaacatcggcattatcctcctg
cttgcaactatagcaacagccttcataggctatgtcctcccgtgaggccaaatatcattc
tgaggggccacagtaattacaaacttactatccgccatcccatacattgggacagaccta
gttcaatgaatctgaggaggctactcagtagacagtcccaccctcacacgattctttacc
tttcacttcatcttgcccttcattattgcagccctagcaacactccacctcctattcttg
cacgaaacgggatcaaacaaccccctaggaatcacctcccattccgataaaatcaccttc
cacccttactacacaatcaaagacgccctcggcttacttctcttccttctctccttaatg
acattaacactattctcaccagacctcctaggcgacccagacaattataccctagccaac
cccttaaacacccctccccacatcaagcccgaatgatatttcctattcgcctacacaatt
ctccgatccgtccctaacaaactaggaggcgtccttgccctattactatccatcctcatc
ctagcaataatccccatcctccatatatccaaacaacaaagcataatatttcgcccacta
agccaatcactttattgactcctagccgcagacctcctcattctaacctgaatcggagga
caaccagtaagctacccttttaccatcattggacaagtagcatccgtactatacttcaca
acaatcctaatcctaataccaactatctccctaattgaaaacaaaatactcaaatgggcc
t

KEGG   Homo sapiens (human): 7381
Entry
7381              CDS       T01001                                 

Gene name
UQCRB, MC3DN3, QCR7, QP-C, QPC, UQBC, UQBP, UQCR6, UQPC
Definition
(RefSeq) ubiquinol-cytochrome c reductase binding protein
  KO
K00417  ubiquinol-cytochrome c reductase subunit 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7381 (UQCRB)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7381 (UQCRB)
  09159 Environmental adaptation
   04714 Thermogenesis
    7381 (UQCRB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7381 (UQCRB)
   05012 Parkinson disease
    7381 (UQCRB)
   05014 Amyotrophic lateral sclerosis
    7381 (UQCRB)
   05016 Huntington disease
    7381 (UQCRB)
   05020 Prion disease
    7381 (UQCRB)
   05022 Pathways of neurodegeneration - multiple diseases
    7381 (UQCRB)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7381 (UQCRB)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7381 (UQCRB)
SSDB
Motif
Pfam: UCR_14kD
Other DBs
NCBI-GeneID: 7381
NCBI-ProteinID: NP_006285
OMIM: 191330
HGNC: 12582
Ensembl: ENSG00000156467
Vega: OTTHUMG00000164711
Pharos: P14927(Tbio)
UniProt: P14927
LinkDB
Structure
PDB: 
5XTE

Position
8q22.1
AA seq 111 aa
MAGKQAVSASGKWLDGIRKWYYNAAGFNKLGLMRDDTIYEDEDVKEAIRRLPENLYNDRM
FRIKRALDLNLKHQILPKEQWTKYEEENFYLEPYLKEVIRERKEREEWAKK
NT seq 336 nt   +upstreamnt  +downstreamnt
atggctggtaagcaggccgtttcagcatcaggcaagtggctggatggtattcgaaaatgg
tattacaatgctgcaggattcaataaactggggttaatgcgagatgatacaatatacgag
gatgaagatgtaaaagaagccataagaagacttcctgagaacctttataatgacaggatg
tttcgcattaagagggcactggacctgaacttgaagcatcagatcttgcctaaagagcag
tggaccaaatatgaagaggaaaatttctaccttgaaccgtatctgaaagaggttattcgg
gaaagaaaagaaagagaagaatgggcaaagaagtaa

KEGG   Homo sapiens (human): 7384
Entry
7384              CDS       T01001                                 

Gene name
UQCRC1, D3S3191, PKNPY, QCR1, UQCR1
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7384 (UQCRC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7384 (UQCRC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7384 (UQCRC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7384 (UQCRC1)
   05012 Parkinson disease
    7384 (UQCRC1)
   05014 Amyotrophic lateral sclerosis
    7384 (UQCRC1)
   05016 Huntington disease
    7384 (UQCRC1)
   05020 Prion disease
    7384 (UQCRC1)
   05022 Pathways of neurodegeneration - multiple diseases
    7384 (UQCRC1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7384 (UQCRC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7384 (UQCRC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7384 (UQCRC1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M16: pitrilysin family
   7384 (UQCRC1)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Other DBs
NCBI-GeneID: 7384
NCBI-ProteinID: NP_003356
OMIM: 191328
HGNC: 12585
Ensembl: ENSG00000010256
Vega: OTTHUMG00000133539
Pharos: P31930(Tbio)
UniProt: P31930
LinkDB
Structure
PDB: 
5XTE

Position
3p21.31
AA seq 480 aa
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcgtccgtggtctgtcgggccgctaccgccggggcacaagtgctattgcgcgcc
cgccgctcgccggccctgctgcggacgccagccttgcggagtacggcaaccttcgctcag
gcgctccagttcgtgccggagacgcaggttagcctgctggacaacggcctgcgtgtggcc
tccgagcagtcctctcagcccacttgcacggtgggagtgtggattgatgttggcagccgt
tttgagactgagaagaataatggggcaggctactttttggagcatctggctttcaaggga
acaaagaatcggcctggcagtgccctggagaaggaggtggagagcatgggggcccatctt
aatgcctacagcacccgggagcacacagcttactacatcaaggcgctgtccaaggatctg
ccgaaagctgtggagctcctgggtgacattgtgcagaactgtagtctggaagactcacag
attgagaaggaacgtgatgtgatcctgcgggagatgcaggagaatgatgcatctatgcga
gatgtggtctttaactacctgcatgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaatgtcaggaagctgtctcgtgcagacttgaccgagtacctc
agcacacattacaaggcccctcgaatggtgctggcagcagctggaggagtggagcaccag
caactgttagacctcgcccagaagcacctcggtggcatcccatggacatatgcagaggac
gctgtgcccactcttactccatgccgcttcactggcagtgagatccgccaccgtgatgat
gctctaccttttgcccacgtggccattgcagtagagggtcctggctgggccagcccggac
aatgtggccttgcaagtggccaatgccatcatcggccactatgactgcacttatggtggt
ggcgtgcacctgtccagcccactggcttcaggtgctgtggccaacaagctatgccagagt
ttccagaccttcagcatctgctatgcagagacgggcttgctgggtgcacactttgtctgt
gaccgaatgaaaatcgatgacatgatgttcgtcctgcaagggcagtggatgcgcctgtgt
accagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccctggta
tctcatctagatggcactactcctgtgtgtgaggacatcggacgcagcctcctgacctat
ggccgccgcatccccctggctgaatgggaaagccggattgcggaggtggatgccagtgtg
gtacgtgagatctgctccaagtacatctatgaccagtgcccagcagtggctggatatggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgcttc
tag

KEGG   Homo sapiens (human): 7385
Entry
7385              CDS       T01001                                 

Gene name
UQCRC2, MC3DN5, QCR2, UQCR2
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 2
  KO
K00415  ubiquinol-cytochrome c reductase core subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Disease
H02086  Mitochondrial complex III deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7385 (UQCRC2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7385 (UQCRC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    7385 (UQCRC2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7385 (UQCRC2)
   05012 Parkinson disease
    7385 (UQCRC2)
   05014 Amyotrophic lateral sclerosis
    7385 (UQCRC2)
   05016 Huntington disease
    7385 (UQCRC2)
   05020 Prion disease
    7385 (UQCRC2)
   05022 Pathways of neurodegeneration - multiple diseases
    7385 (UQCRC2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7385 (UQCRC2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7385 (UQCRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7385 (UQCRC2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M16: pitrilysin family
   7385 (UQCRC2)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C DUF1471
Other DBs
NCBI-GeneID: 7385
NCBI-ProteinID: NP_003357
OMIM: 191329
HGNC: 12586
Ensembl: ENSG00000140740
Vega: OTTHUMG00000131585
Pharos: P22695(Tbio)
UniProt: P22695
LinkDB
Structure
PDB: 
5XTE

Position
16p12.2
AA seq 453 aa
MKLLTRAGSFSRFYSLKVAPKVKATAAPAGAPPQPQDLEFTKLPNGLVIASLENYSPVSR
IGLFIKAGSRYEDFSNLGTTHLLRLTSSLTTKGASSFKITRGIEAVGGKLSVTATRENMA
YTVECLRGDVDILMEFLLNVTTAPEFRRWEVADLQPQLKIDKAVAFQNPQTHVIENLHAA
AYRNALANPLYCPDYRIGKVTSEELHYFVQNHFTSARMALIGLGVSHPVLKQVAEQFLNM
RGGLGLSGAKANYRGGEIREQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK
RGSNTTSHLHQAVAKATQQPFDVSAFNASYSDSGLFGIYTISQATAAGDVIKAAYNQVKT
IAQGNLSNTDVQAAKNKLKAGYLMSVESSECFLEEVGSQALVAGSYMPPSTVLQQIDSVA
NADIINAAKKFVSGQKSMAASGNLGHTPFVDEL
NT seq 1362 nt   +upstreamnt  +downstreamnt
atgaagctactaaccagagccggctctttctcgagattttattccctcaaagttgccccc
aaagttaaagccacagctgcgcctgcaggagcaccgccacaacctcaggaccttgagttt
accaagttaccaaatggcttggtgattgcttctttggaaaactattctcctgtatcaaga
attggtttgttcattaaagcaggcagtagatatgaggacttcagcaatttaggaaccacc
catttgctgcgtcttacatccagtctgacgacaaaaggagcttcatctttcaagataacc
cgtggaattgaagcagttggtggcaaattaagtgtgaccgcaacaagggaaaacatggct
tatactgtggaatgcctgcggggtgatgttgatattctaatggagttcctgctcaatgtc
accacagcaccagaatttcgtcgttgggaagtagctgaccttcagcctcagctaaagatt
gacaaagctgtggcctttcagaatccgcagactcatgtcattgaaaatttgcatgcagca
gcttaccggaatgccttggctaatcccttgtattgtcctgactataggattggaaaagtg
acatcagaggagttacattacttcgttcagaaccatttcacaagtgcaagaatggctttg
attggacttggtgtgagtcatcctgttctaaagcaagttgctgaacagtttctcaacatg
aggggtgggcttggtttatctggtgcaaaggccaactaccgtggaggtgaaatccgagaa
cagaatggagacagtcttgtccatgctgcttttgtagcagaaagtgctgtcgcgggaagt
gcagaggcaaatgcatttagtgttcttcagcatgtcctcggtgctgggccacatgtcaag
aggggcagcaacaccaccagccatctgcaccaggctgttgccaaggcaactcagcagcca
tttgatgtttctgcatttaatgccagttactcagattctggactctttgggatttatact
atctcccaggccacagctgctggagatgttatcaaggctgcctataatcaagtaaaaaca
atagctcaaggaaacctttccaacacagatgtccaagctgccaagaacaagctgaaagct
ggatacctaatgtcagtggagtcttctgagtgtttcctggaagaagtcgggtcccaggct
ctagttgctggttcttacatgccaccatccacagtccttcagcagattgattcagtggct
aatgctgatatcataaatgcggcaaagaagtttgtttctggccagaagtcaatggcagca
agtggaaatttgggacatacaccttttgttgatgagttgtaa

KEGG   Homo sapiens (human): 7386
Entry
7386              CDS       T01001                                 

Gene name
UQCRFS1, MC3DN10, RIP1, RIS1, RISP, UQCR5
Definition
(RefSeq) ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00151  Cytochrome bc1 complex respiratory unit
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7386 (UQCRFS1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7386 (UQCRFS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7386 (UQCRFS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7386 (UQCRFS1)
   05012 Parkinson disease
    7386 (UQCRFS1)
   05014 Amyotrophic lateral sclerosis
    7386 (UQCRFS1)
   05016 Huntington disease
    7386 (UQCRFS1)
   05020 Prion disease
    7386 (UQCRFS1)
   05022 Pathways of neurodegeneration - multiple diseases
    7386 (UQCRFS1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7386 (UQCRFS1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7386 (UQCRFS1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     7386 (UQCRFS1)
SSDB
Motif
Pfam: UCR_TM Ubiq-Cytc-red_N Rieske TPK_B1_binding
Other DBs
NCBI-GeneID: 7386
NCBI-ProteinID: NP_005994
OMIM: 191327
HGNC: 12587
Ensembl: ENSG00000169021
Vega: OTTHUMG00000181997
Pharos: P47985(Tbio)
UniProt: P47985
LinkDB
Structure
PDB: 
5XTE

Position
19q12
AA seq 274 aa
MLSVASRSGPFAPVLSATSRGVAGALRPLVQATVPATPEQPVLDLKRPFLSRESLSGQAV
RRPLVASVGLNVPASVCYSHTDIKVPDFSEYRRLEVLDSTKSSRESSEARKGFSYLVTGV
TTVGVAYAAKNAVTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRT
QKEIEQEAAVELSQLRDPQHDLDRVKKPEWVILIGVCTHLGCVPIANAGDFGGYYCPCHG
SHYDASGRIRLGPAPLNLEVPTYEFTSDDMVIVG
NT seq 825 nt   +upstreamnt  +downstreamnt
atgttgtcggtagcatcccgctcaggcccgttcgcgcccgtcctgtcggccacgtcccgc
ggggtggcgggcgcgctgcggcccttggtgcaggccacggtgcccgccaccccggagcag
cctgtgttggacctgaagcggcccttcctcagccgggagtcgctgagcggccaggccgtg
cgccggcctttggtcgcctccgtgggcctcaatgtccctgcttctgtttgttattcccac
acagacatcaaggtgcctgacttctctgaataccgccgccttgaagttttagatagtacg
aagtcttcaagagaaagcagcgaggctaggaaaggtttctcctatttggtaactggagta
actactgtgggtgtcgcatatgctgccaagaatgccgtcacccagttcgtttccagcatg
agtgcttctgctgatgtgttggccctggcgaaaatcgaaatcaagttatccgatattcca
gaaggcaagaacatggctttcaaatggagaggcaaacccctgtttgtgcgtcatagaacc
cagaaggaaattgagcaggaagctgcagttgaattatcacagttgagggacccacagcat
gatctagatcgagtaaagaaacctgaatgggttatcctgataggtgtttgcactcatctt
ggctgtgtacccattgcaaatgcaggagattttggtggttattactgcccttgccatggg
tcacactatgatgcatctggcaggatcagattgggtcctgctcctctcaaccttgaagtc
cccacgtatgagttcaccagtgacgatatggtgattgttggttaa

KEGG   Homo sapiens (human): 7388
Entry
7388              CDS       T01001                                 

Gene name
UQCRH, QCR6, UQCR8
Definition
(RefSeq) ubiquinol-cytochrome c reductase hinge protein
  KO
K00416  ubiquinol-cytochrome c reductase subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7388 (UQCRH)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7388 (UQCRH)
  09159 Environmental adaptation
   04714 Thermogenesis
    7388 (UQCRH)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7388 (UQCRH)
   05012 Parkinson disease
    7388 (UQCRH)
   05014 Amyotrophic lateral sclerosis
    7388 (UQCRH)
   05016 Huntington disease
    7388 (UQCRH)
   05020 Prion disease
    7388 (UQCRH)
   05022 Pathways of neurodegeneration - multiple diseases
    7388 (UQCRH)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7388 (UQCRH)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7388 (UQCRH)
SSDB
Motif
Pfam: UCR_hinge Syntaxin-6_N
Other DBs
NCBI-GeneID: 7388
NCBI-ProteinID: NP_005995
OMIM: 613844
HGNC: 12590
Ensembl: ENSG00000173660
Vega: OTTHUMG00000007813
Pharos: P07919(Tdark)
UniProt: P07919
LinkDB
Structure
PDB: 
5XTE

Position
1p33
AA seq 91 aa
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELCDERVSSR
SHTEEDCTEELFDFLHARDHCVAHKLFNNLK
NT seq 276 nt   +upstreamnt  +downstreamnt
atgggactggaggacgagcaaaagatgcttaccgaatccggagatcctgaggaggaggaa
gaggaagaggaggaattagtggatcccctaacaacagtgagagagcaatgcgagcagttg
gagaaatgtgtaaaggcccgggagcggctagagctctgtgatgagcgtgtatcctctcga
tcacatacagaagaggattgcacggaggagctctttgacttcttgcatgcgagggaccat
tgcgtggcccacaaactctttaacaacttgaaataa

KEGG   Homo sapiens (human): 84701
Entry
84701             CDS       T01001                                 

Gene name
COX4I2, COX4, COX4-2, COX4B, COX4L2, COXIV-2, dJ857M17.2
Definition
(RefSeq) cytochrome c oxidase subunit 4I2
  KO
K02263  cytochrome c oxidase subunit 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Disease
H00920  Exocrine pancreatic insufficiency, dyserythropoietic anemia, and calvarial hyperostosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    84701 (COX4I2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    84701 (COX4I2)
  09159 Environmental adaptation
   04714 Thermogenesis
    84701 (COX4I2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    84701 (COX4I2)
   05012 Parkinson disease
    84701 (COX4I2)
   05014 Amyotrophic lateral sclerosis
    84701 (COX4I2)
   05016 Huntington disease
    84701 (COX4I2)
   05020 Prion disease
    84701 (COX4I2)
   05022 Pathways of neurodegeneration - multiple diseases
    84701 (COX4I2)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    84701 (COX4I2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    84701 (COX4I2)
SSDB
Motif
Pfam: COX4
Other DBs
NCBI-GeneID: 84701
NCBI-ProteinID: NP_115998
OMIM: 607976
HGNC: 16232
Ensembl: ENSG00000131055
Vega: OTTHUMG00000032180
Pharos: Q96KJ9(Tbio)
UniProt: Q96KJ9 H6SG14
LinkDB
Position
20q11.21
AA seq 171 aa
MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAE
EQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVI
WWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
NT seq 516 nt   +upstreamnt  +downstreamnt
atgctccccagagctgcctggagcttggtgctgaggaaaggtggaggtggaagacgaggg
atgcacagctcagaaggcaccacccgtggtggggggaagatgtccccctacaccaactgc
tatgcccagcgctactaccccatgccagaagagcccttctgcacagaactcaacgctgag
gagcaggccctgaaggagaaggagaagggaagctggacccagctgacccacgccgaaaag
gtggccttgtaccggctccagttcaatgagacctttgcggagatgaaccgtcgctccaat
gagtggaagacagtgatgggttgtgtcttcttcttcattggattcgcagctctggtgatt
tggtggcagcgggtctacgtatttcctccaaagccgatcaccttgacggacgagcggaaa
gcccagcagctgcagcgcatgctggacatgaaggtgaatcctgtgcagggcctggcctcc
cgctgggactatgagaagaagcagtggaagaagtga

KEGG   Homo sapiens (human): 9167
Entry
9167              CDS       T01001                                 

Gene name
COX7A2L, COX7AR, COX7RP, EB1, SCAF1, SCAFI, SIG81
Definition
(RefSeq) cytochrome c oxidase subunit 7A2 like
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9167 (COX7A2L)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    9167 (COX7A2L)
  09159 Environmental adaptation
   04714 Thermogenesis
    9167 (COX7A2L)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9167 (COX7A2L)
   05012 Parkinson disease
    9167 (COX7A2L)
   05014 Amyotrophic lateral sclerosis
    9167 (COX7A2L)
   05016 Huntington disease
    9167 (COX7A2L)
   05020 Prion disease
    9167 (COX7A2L)
   05022 Pathways of neurodegeneration - multiple diseases
    9167 (COX7A2L)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    9167 (COX7A2L)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    9167 (COX7A2L)
SSDB
Motif
Pfam: COX7a
Other DBs
NCBI-GeneID: 9167
NCBI-ProteinID: NP_001305965
OMIM: 605771
HGNC: 2289
Ensembl: ENSG00000115944
Vega: OTTHUMG00000128605
Pharos: O14548(Tdark)
UniProt: O14548 Q6FGA0
LinkDB
Position
2p21
AA seq 114 aa
MYYKFSGFTQKLAGAWASEAYSPQGLKPVVSTEAPPIIFATPTKLTSDSTVYDYAGKNKV
PELQKFFQKADGVPVYLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt   +upstreamnt  +downstreamnt
atgtactacaagtttagtggcttcacgcagaagttggcaggagcatgggcttcggaggcc
tatagcccgcagggattaaagcctgtggtttccacagaagcaccacctatcatatttgcc
acaccaactaaactgacctccgattccacagtgtatgattatgctgggaaaaacaaagtt
ccagagctacaaaagtttttccagaaagctgatggtgtgcccgtctacctgaaacgaggc
ctgcctgaccaaatgctttaccggaccaccatggcgctgactgtgggagggaccatctac
tgcctgatcgccctctacatggcttcgcagcccaaaaacaaatga

KEGG   Homo sapiens (human): 9377
Entry
9377              CDS       T01001                                 

Gene name
COX5A, COX, COX-VA, MC4DN20, VA
Definition
(RefSeq) cytochrome c oxidase subunit 5A
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    9377 (COX5A)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    9377 (COX5A)
  09159 Environmental adaptation
   04714 Thermogenesis
    9377 (COX5A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    9377 (COX5A)
   05012 Parkinson disease
    9377 (COX5A)
   05014 Amyotrophic lateral sclerosis
    9377 (COX5A)
   05016 Huntington disease
    9377 (COX5A)
   05020 Prion disease
    9377 (COX5A)
   05022 Pathways of neurodegeneration - multiple diseases
    9377 (COX5A)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    9377 (COX5A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    9377 (COX5A)
SSDB
Motif
Pfam: COX5A
Other DBs
NCBI-GeneID: 9377
NCBI-ProteinID: NP_004246
OMIM: 603773
HGNC: 2267
Ensembl: ENSG00000178741
Vega: OTTHUMG00000142825
Pharos: P20674(Tbio)
UniProt: P20674
LinkDB
Structure
PDB: 
5Z62

Position
15q24.2
AA seq 150 aa
MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYF
NKPDIDAWELRKGINTLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHK
EIYPYVIQELRPTLNELGISTPEELGLDKV
NT seq 453 nt   +upstreamnt  +downstreamnt
atgctgggcgccgctctccgccgctgcgctgtggccgcaaccacccgggccgaccctcga
ggcctcctgcactccgcccggacccccggccccgccgtggctatccagtcagttcgctgc
tattcccatgggtcacaggagacagatgaggagtttgatgctcgctgggtaacatacttc
aacaagccagatatagatgcctgggaattgcgtaaagggataaacacacttgttacctat
gatatggttccagagcccaaaatcattgatgctgctttgcgggcatgcagacggttaaat
gattttgctagtacagttcgtatcctagaggttgttaaggacaaagcaggacctcataag
gaaatctacccctatgtcatccaggaacttagaccaactttaaatgaactgggaatctcc
actccggaggaactgggccttgacaaagtgtaa

DBGET integrated database retrieval system