KEGG   Homo sapiens (human): 1571
Entry
1571              CDS       T01001                                 
Symbol
CYP2E1, CPE1, CYP2E, P450-J, P450C2E
Name
(RefSeq) cytochrome P450 family 2 subfamily E member 1
  KO
K07415  cytochrome P450 family 2 subfamily E1 [EC:1.14.14.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04932  Non-alcoholic fatty liver disease
hsa04936  Alcoholic liver disease
hsa05204  Chemical carcinogenesis - DNA adducts
hsa05208  Chemical carcinogenesis - reactive oxygen species
Network
nt06250  DNA adduct formation
nt06251  CYP-mediated ROS formation
  Element
N01383  NDMA to DNA adducts
N01385  VC to DNA adducts
N01399  Benzene to CYP-mediated metabolism
N01400  Benzene to CYP-mediated metabolism
N01406  Ethanol to CYP-mediated metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    1571 (CYP2E1)
   00590 Arachidonic acid metabolism
    1571 (CYP2E1)
   00591 Linoleic acid metabolism
    1571 (CYP2E1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    1571 (CYP2E1)
   00982 Drug metabolism - cytochrome P450
    1571 (CYP2E1)
   00983 Drug metabolism - other enzymes
    1571 (CYP2E1)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    1571 (CYP2E1)
   05208 Chemical carcinogenesis - reactive oxygen species
    1571 (CYP2E1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    1571 (CYP2E1)
   04932 Non-alcoholic fatty liver disease
    1571 (CYP2E1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    1571 (CYP2E1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.-
     1571 (CYP2E1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP2 family
   1571 (CYP2E1)
SSDB
Motif
Pfam: p450 DUF6361
Other DBs
NCBI-GeneID: 1571
NCBI-ProteinID: NP_000764
OMIM: 124040
HGNC: 2631
Ensembl: ENSG00000130649
Pharos: P05181(Tbio)
UniProt: P05181
Structure
LinkDB
Position
10:133527363..133539123
AA seq 493 aa
MSALGVTVALLVWAAFLLLVSMWRQVHSSWNLPPGPFPLPIIGNLFQLELKNIPKSFTRL
AQRFGPVFTLYVGSQRMVVMHGYKAVKEALLDYKDEFSGRGDLPAFHAHRDRGIIFNNGP
TWKDIRRFSLTTLRNYGMGKQGNESRIQREAHFLLEALRKTQGQPFDPTFLIGCAPCNVI
ADILFRKHFDYNDEKFLRLMYLFNENFHLLSTPWLQLYNNFPSFLHYLPGSHRKVIKNVA
EVKEYVSERVKEHHQSLDPNCPRDLTDCLLVEMEKEKHSAERLYTMDGITVTVADLFFAG
TETTSTTLRYGLLILMKYPEIEEKLHEEIDRVIGPSRIPAIKDRQEMPYMDAVVHEIQRF
ITLVPSNLPHEATRDTIFRGYLIPKGTVVVPTLDSVLYDNQEFPDPEKFKPEHFLNENGK
FKYSDYFKPFSTGKRVCAGEGLARMELFLLLCAILQHFNLKPLVDPKDIDLSPIHIGFGC
IPPRYKLCVIPRS
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtctgccctcggagtcaccgtggccctgctggtgtgggcggccttcctcctgctggtg
tccatgtggaggcaggtgcacagcagctggaatctgcccccaggccctttcccgcttccc
atcatcgggaacctcttccagttggaattgaagaatattcccaagtccttcacccggttg
gcccagcgcttcgggccggtgttcacgctgtacgtgggctcgcagcgcatggtggtgatg
cacggctacaaggcggtgaaggaagcgctgctggactacaaggacgagttctcgggcaga
ggcgacctccccgcgttccatgcgcacagggacaggggaatcatttttaataatggacct
acctggaaggacatccggcggttttccctgaccaccctccggaactatgggatggggaaa
cagggcaatgagagccggatccagagggaggcccacttcctgctggaagcactcaggaag
acccaaggccagcctttcgaccccaccttcctcatcggctgcgcgccctgcaacgtcata
gccgacatcctcttccgcaagcattttgactacaatgatgagaagtttctaaggctgatg
tatttgtttaatgagaacttccacctactcagcactccctggctccagctttacaataat
tttcccagctttctacactacttgcctggaagccacagaaaagtcataaaaaatgtggct
gaagtaaaagagtatgtgtctgaaagggtgaaggagcaccatcaatctctggaccccaac
tgtccccgggacctcaccgactgcctgctcgtggaaatggagaaggaaaagcacagtgca
gagcgcttgtacacaatggacggtatcaccgtgactgtggccgacctgttctttgcgggg
acagagaccaccagcacaactctgagatatgggctcctgattctcatgaaataccctgag
atcgaagagaagctccatgaagaaattgacagggtgattgggccaagccgaatccctgcc
atcaaggataggcaagagatgccctacatggatgctgtggtgcatgagattcagcggttc
atcaccctcgtgccctccaacctgccccatgaagcaacccgagacaccattttcagagga
tacctcatccccaagggcacagtcgtagtgccaactctggactctgttttgtatgacaac
caagaatttcctgatccagaaaagtttaagccagaacacttcctgaatgaaaatggaaag
ttcaagtacagtgactatttcaagccattttccacaggaaaacgagtgtgtgctggagaa
ggcctggctcgcatggagttgtttcttttgttgtgtgccattttgcagcattttaatttg
aagcctctcgttgacccaaaggatatcgacctcagccctatacatattgggtttggctgt
atcccaccacgttacaaactctgtgtcattccccgctcatga

DBGET integrated database retrieval system