KEGG   Homo sapiens (human): 1803
Entry
1803              CDS       T01001                                 

Gene name
DPP4, ADABP, ADCP2, CD26, DPPIV, TP103
Definition
(RefSeq) dipeptidyl peptidase 4
  KO
K01278  dipeptidyl-peptidase 4 [EC:3.4.14.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04974  Protein digestion and absorption
Drug target
Alogliptin: D06553<JP/US>
Anagliptin: D09780<JP>
Carmegliptin (DG01281): D08631 D09326
Denagliptin tosylate: D06578
Dutogliptin (DG01282): D09333 D09334
Evogliptin: D11023
Gemigliptin: D10502
Gosogliptin: D09625
Linagliptin: D09566<JP/US>
Omarigliptin: D10317<JP>
Saxagliptin (DG00119): D08996 D09753<JP> D10262<US>
Sitagliptin (DG00118): D06645<JP/US> D08516
Teneligliptin (DG01283): D08616 D09756<JP> D11968
Trelagliptin (DG01284): D10178 D10179<JP>
Vildagliptin: D07080<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    1803 (DPP4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1803 (DPP4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1803 (DPP4)
   04090 CD molecules [BR:hsa04090]
    1803 (DPP4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.5  dipeptidyl-peptidase IV
     1803 (DPP4)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   1803 (DPP4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   1803 (DPP4)
  Exosomal proteins of epithelial cells
   1803 (DPP4)
  Exosomal proteins of colorectal cancer cells
   1803 (DPP4)
CD molecules [BR:hsa04090]
 Proteins
  1803 (DPP4)
SSDB
Motif
Pfam: DPPIV_N Peptidase_S9 DPPIV_rep DLH LIP Hydrolase_4 Abhydrolase_6 Abhydrolase_3 Abhydrolase_2 Peptidase_S15
Other DBs
NCBI-GeneID: 1803
NCBI-ProteinID: NP_001926
OMIM: 102720
HGNC: 3009
Ensembl: ENSG00000197635
Vega: OTTHUMG00000132056
Pharos: P27487(Tclin)
UniProt: P27487
LinkDB
Structure
PDB: 

Position
2q24.2
AA seq 766 aa
MKTPWKVLLGLLGAAALVTIITVPVVLLNKGTDDATADSRKTYTLTDYLKNTYRLKLYSL
RWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISPDGQFILLEYNY
VKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNL
PSYRITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSF
YSDESLQYPKTVRVPYPKAGAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYL
CDVTWATQERISLQWLRRIQNYSVMDICDYDESSGRWNCLVARQHIEMSTTGWVGRFRPS
EPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEALTSDYLYYISN
EYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLY
TLHSSVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKY
PLLLDVYAGPCSQKADTVFRLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGT
FEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWE
YYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQIS
KALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP
NT seq 2301 nt   +upstreamnt  +downstreamnt
atgaagacaccgtggaaggttcttctgggactgctgggtgctgctgcgcttgtcaccatc
atcaccgtgcccgtggttctgctgaacaaaggcacagatgatgctacagctgacagtcgc
aaaacttacactctaactgattacttaaaaaatacttatagactgaagttatactcctta
agatggatttcagatcatgaatatctctacaaacaagaaaataatatcttggtattcaat
gctgaatatggaaacagctcagttttcttggagaacagtacatttgatgagtttggacat
tctatcaatgattattcaatatctcctgatgggcagtttattctcttagaatacaactac
gtgaagcaatggaggcattcctacacagcttcatatgacatttatgatttaaataaaagg
cagctgattacagaagagaggattccaaacaacacacagtgggtcacatggtcaccagtg
ggtcataaattggcatatgtttggaacaatgacatttatgttaaaattgaaccaaattta
ccaagttacagaatcacatggacggggaaagaagatataatatataatggaataactgac
tgggtttatgaagaggaagtcttcagtgcctactctgctctgtggtggtctccaaacggc
acttttttagcatatgcccaatttaacgacacagaagtcccacttattgaatactccttc
tactctgatgagtcactgcagtacccaaagactgtacgggttccatatccaaaggcagga
gctgtgaatccaactgtaaagttctttgttgtaaatacagactctctcagctcagtcacc
aatgcaacttccatacaaatcactgctcctgcttctatgttgataggggatcactacttg
tgtgatgtgacatgggcaacacaagaaagaatttctttgcagtggctcaggaggattcag
aactattcggtcatggatatttgtgactatgatgaatccagtggaagatggaactgctta
gtggcacggcaacacattgaaatgagtactactggctgggttggaagatttaggccttca
gaacctcattttacccttgatggtaatagcttctacaagatcatcagcaatgaagaaggt
tacagacacatttgctatttccaaatagataaaaaagactgcacatttattacaaaaggc
acctgggaagtcatcgggatagaagctctaaccagtgattatctatactacattagtaat
gaatataaaggaatgccaggaggaaggaatctttataaaatccaacttagtgactataca
aaagtgacatgcctcagttgtgagctgaatccggaaaggtgtcagtactattctgtgtca
ttcagtaaagaggcgaagtattatcagctgagatgttccggtcctggtctgcccctctat
actctacacagcagcgtgaatgataaagggctgagagtcctggaagacaattcagctttg
gataaaatgctgcagaatgtccagatgccctccaaaaaactggacttcattattttgaat
gaaacaaaattttggtatcagatgatcttgcctcctcattttgataaatccaagaaatat
cctctactattagatgtgtatgcaggcccatgtagtcaaaaagcagacactgtcttcaga
ctgaactgggccacttaccttgcaagcacagaaaacattatagtagctagctttgatggc
agaggaagtggttaccaaggagataagatcatgcatgcaatcaacagaagactgggaaca
tttgaagttgaagatcaaattgaagcagccagacaattttcaaaaatgggatttgtggac
aacaaacgaattgcaatttggggctggtcatatggagggtacgtaacctcaatggtcctg
ggatcgggaagtggcgtgttcaagtgtggaatagccgtggcgcctgtatcccggtgggag
tactatgactcagtgtacacagaacgttacatgggtctcccaactccagaagacaacctt
gaccattacagaaattcaacagtcatgagcagagctgaaaattttaaacaagttgagtac
ctccttattcatggaacagcagatgataacgttcactttcagcagtcagctcagatctcc
aaagccctggtcgatgttggagtggatttccaggcaatgtggtatactgatgaagaccat
ggaatagctagcagcacagcacaccaacatatatatacccacatgagccacttcataaaa
caatgtttctctttaccttag

DBGET integrated database retrieval system