KEGG   Homo sapiens (human): 3445
Entry
3445              CDS       T01001                                 

Symbol
IFNA8, IFN-alphaB
Name
(RefSeq) interferon alpha 8
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04936  Alcoholic liver disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3445 (IFNA8)
   04151 PI3K-Akt signaling pathway
    3445 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3445 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3445 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3445 (IFNA8)
   04621 NOD-like receptor signaling pathway
    3445 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    3445 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    3445 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    3445 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3445 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3445 (IFNA8)
   05161 Hepatitis B
    3445 (IFNA8)
   05160 Hepatitis C
    3445 (IFNA8)
   05171 Coronavirus disease - COVID-19
    3445 (IFNA8)
   05164 Influenza A
    3445 (IFNA8)
   05162 Measles
    3445 (IFNA8)
   05168 Herpes simplex virus 1 infection
    3445 (IFNA8)
   05163 Human cytomegalovirus infection
    3445 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3445 (IFNA8)
   05169 Epstein-Barr virus infection
    3445 (IFNA8)
   05165 Human papillomavirus infection
    3445 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3445 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3445 (IFNA8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3445 (IFNA8)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3445 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3445 (IFNA8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3445 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3445
NCBI-ProteinID: NP_002161
OMIM: 147568
HGNC: 5429
Ensembl: ENSG00000120242
Vega: OTTHUMG00000019677
Pharos: P32881(Tbio)
UniProt: P32881 A0A7R8C381
LinkDB
Position
9p21.3
AA seq 189 aa
MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE
FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE
SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc
tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttgatactc
ctggcacaaatgcgaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgctttg
gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgatagagtctcccctgatgtacgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctatatctgacagagaagaaatacagc
tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaatga

DBGET integrated database retrieval system