Entry |
|
Symbol |
IFNA21, IFN-alphaI, LeIF_F, leIF-F
|
Name |
(RefSeq) interferon alpha 21
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa04622 | RIG-I-like receptor signaling pathway |
hsa04650 | Natural killer cell mediated cytotoxicity |
hsa05163 | Human cytomegalovirus infection |
hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
hsa05168 | Herpes simplex virus 1 infection |
hsa05170 | Human immunodeficiency virus 1 infection |
|
Network |
|
Element |
N00148 | TLR3-IRF7 signaling pathway |
N00150 | Type I IFN signaling pathway |
N00395 | cGAS-STING signaling pathway |
N00436 | HIV Tat to TLR2/4-NFKB signaling pathway |
N00469 | RIG-I-IRF7/3 signaling pathway |
N00688 | RIG-I-NFKB signaling pathway |
N00690 | TLR7/9-IRF7 signaling pathway |
N01308 | MDA5-IRF7/3 signaling pathway |
N01543 | TLR7/8/9-IRF5 signaling pathway |
N01558 | Type I interferon to Jak-STAT signaling pathway |
N01559 | Type II interferon to Jak-STAT signaling pathway |
N01662 | IFN-RIPK1/3 signaling pathway |
|
Drug target |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
3452 (IFNA21)
04151 PI3K-Akt signaling pathway
3452 (IFNA21)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
3452 (IFNA21)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
3452 (IFNA21)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
3452 (IFNA21)
04621 NOD-like receptor signaling pathway
3452 (IFNA21)
04622 RIG-I-like receptor signaling pathway
3452 (IFNA21)
04623 Cytosolic DNA-sensing pathway
3452 (IFNA21)
04650 Natural killer cell mediated cytotoxicity
3452 (IFNA21)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
3452 (IFNA21)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
3452 (IFNA21)
05161 Hepatitis B
3452 (IFNA21)
05160 Hepatitis C
3452 (IFNA21)
05171 Coronavirus disease - COVID-19
3452 (IFNA21)
05164 Influenza A
3452 (IFNA21)
05162 Measles
3452 (IFNA21)
05168 Herpes simplex virus 1 infection
3452 (IFNA21)
05163 Human cytomegalovirus infection
3452 (IFNA21)
05167 Kaposi sarcoma-associated herpesvirus infection
3452 (IFNA21)
05169 Epstein-Barr virus infection
3452 (IFNA21)
05165 Human papillomavirus infection
3452 (IFNA21)
09171 Infectious disease: bacterial
05152 Tuberculosis
3452 (IFNA21)
09163 Immune disease
05320 Autoimmune thyroid disease
3452 (IFNA21)
09166 Cardiovascular disease
05417 Lipid and atherosclerosis
3452 (IFNA21)
09167 Endocrine and metabolic disease
04936 Alcoholic liver disease
3452 (IFNA21)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and neuropeptides [BR:hsa04052]
3452 (IFNA21)
Cytokines and neuropeptides [BR:hsa04052]
Cytokines
Interferons
3452 (IFNA21)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Position |
9:complement(21165637..21166660)
|
AA seq |
189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLE
ACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKI
FQERLRRKE |
NT seq |
570 nt +upstreamnt +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gaacagagcctcctagaaaaattttccactgaacttaaccagcagctgaatgacctggaa
gcctgcgtgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaaaatt
tttcaagaaagattaaggaggaaggaatga |