KEGG   Homo sapiens (human): 3456
Entry
3456              CDS       T01001                                 

Symbol
IFNB1, IFB, IFF, IFN-beta, IFNB
Name
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa04936  Alcoholic liver disease
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06123  TNF signaling (viruses and bacteria)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00149  TLR3-IRF3 signaling pathway
N00150  Type I IFN signaling pathway
N00374  TNF-IRF1 signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00686  MV N to RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3456 (IFNB1)
   04668 TNF signaling pathway
    3456 (IFNB1)
   04151 PI3K-Akt signaling pathway
    3456 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3456 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3456 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3456 (IFNB1)
   04621 NOD-like receptor signaling pathway
    3456 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    3456 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    3456 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    3456 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3456 (IFNB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3456 (IFNB1)
   05161 Hepatitis B
    3456 (IFNB1)
   05160 Hepatitis C
    3456 (IFNB1)
   05171 Coronavirus disease - COVID-19
    3456 (IFNB1)
   05164 Influenza A
    3456 (IFNB1)
   05162 Measles
    3456 (IFNB1)
   05168 Herpes simplex virus 1 infection
    3456 (IFNB1)
   05163 Human cytomegalovirus infection
    3456 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3456 (IFNB1)
   05169 Epstein-Barr virus infection
    3456 (IFNB1)
   05165 Human papillomavirus infection
    3456 (IFNB1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3456 (IFNB1)
   05135 Yersinia infection
    3456 (IFNB1)
   05152 Tuberculosis
    3456 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    3456 (IFNB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    3456 (IFNB1)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    3456 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3456 (IFNB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3456 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead Ribosomal_S15
Other DBs
NCBI-GeneID: 3456
NCBI-ProteinID: NP_002167
OMIM: 147640
HGNC: 5434
Ensembl: ENSG00000171855
Vega: OTTHUMG00000019652
Pharos: P01574(Tbio)
UniProt: P01574
LinkDB
Structure
PDB: 
1AU1

Position
9p21.3
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcaattttcagtgtcagaag
ctcctgtggcaattgaatgggaggcttgaatactgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag
acagtcctggaagaaaaactggagaaagaagatttcaccaggggaaaactcatgagcagt
ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga
cttacaggttacctccgaaactga

DBGET integrated database retrieval system