KEGG   Homo sapiens (human): 3767
Entry
3767              CDS       T01001                                 
Symbol
KCNJ11, BIR, HHF2, IKATP, KIR6.2, MODY13, PHHI, PNDM2, TNDM3
Name
(RefSeq) potassium inwardly rectifying channel subfamily J member 11
  KO
K05004  potassium inwardly-rectifying channel subfamily J member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04911  Insulin secretion
hsa04929  GnRH secretion
hsa04930  Type II diabetes mellitus
Disease
H00409  Type 2 diabetes mellitus
H00410  Maturity onset diabetes of the young (MODY)
H00512  Permanent neonatal diabetes mellitus
H00513  Transient neonatal diabetes mellitus
H01267  Familial hyperinsulinemic hypoglycemia
Drug target
Amiodarone (DG00204): D00636<JP/US> D02910
Bepridil (DG00333): D00631<JP> D07520
Chlorpropamide: D00271
Diazoxide: D00294<JP/US>
Dronedarone (DG00207): D03914<US>
Glibenclamide: D00336<JP/US>
Glymidine: D01356
Levcromakalim: D02385 D02385
Linogliride (DG02893): D04739 D04740
Minoxidil: D00418<US>
Mitiglinide: D01854<JP>
Naminidil: D05114 D05114
Nateglinide: D01111<JP/US>
Nicorandil: D01810<JP> D01810<JP>
Pinacidil: D05482 D05482
Repaglinide: D00594<JP/US>
Tolazamide: D00379
Tolbutamide (DG00115): D00380 D06177
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    3767 (KCNJ11)
   04929 GnRH secretion
    3767 (KCNJ11)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    3767 (KCNJ11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    3767 (KCNJ11)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Potassium channel, inwardly-rectifying (Kir)
   3767 (KCNJ11)
SSDB
Motif
Pfam: IRK_C IRK Ion_trans Ion_trans_2
Other DBs
NCBI-GeneID: 3767
NCBI-ProteinID: NP_000516
OMIM: 600937
HGNC: 6257
Ensembl: ENSG00000187486
UniProt: Q14654 B2RC52
LinkDB
Position
11:complement(17385248..17389346)
AA seq 390 aa
MLSRKGIIPEEYVLTRLAEDPAKPRYRARQRRARFVSKKGNCNVAHKNIREQGRFLQDVF
TTLVDLKWPHTLLIFTMSFLCSWLLFAMAWWLIAFAHGDLAPSEGTAEPCVTSIHSFSSA
FLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMINAIMLGCIFMKTAQAHRRAET
LIFSKHAVIALRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDANSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQA
RTSYLADEILWGQRFVPIVAEEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDHSLLEALT
LASARGPLRKRSVPMAKAKPKFSISPDSLS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgctgtcccgcaagggcatcatccccgaggaatacgtgctgacacgcctggcagaggac
cctgccaagcccaggtaccgtgcccgccagcggagggcccgctttgtgtccaagaaaggc
aactgcaacgtggcccacaagaacatccgggagcagggccgcttcctgcaggacgtgttc
accacgctggtggacctcaagtggccacacacattgctcatcttcaccatgtccttcctg
tgcagctggctgctcttcgccatggcctggtggctcatcgccttcgcccacggtgacctg
gcccccagcgagggcactgctgagccctgtgtcaccagcatccactccttctcgtctgcc
ttccttttctccattgaggtccaagtgactattggctttggggggcgcatggtgactgag
gagtgcccactggccatcctgatcctcatcgtgcagaacatcgtggggctcatgatcaac
gccatcatgcttggctgcatcttcatgaagactgcccaagcccaccgcagggctgagacc
ctcatcttcagcaagcatgcggtgatcgccctgcgccacggccgcctctgcttcatgcta
cgtgtgggtgacctccgcaagagcatgatcatcagcgccaccatccacatgcaggtggta
cgcaagaccaccagccccgagggcgaggtggtgcccctccaccaggtggacatccccatg
gagaacggcgtgggtggcaacagcatcttcctggtggccccgctgatcatctaccatgtc
attgatgccaacagcccactctacgacctggcacccagcgacctgcaccaccaccaggac
ctcgagatcatcgtcatcctggaaggcgtggtggaaaccacgggcatcaccacccaggcc
cgcacctcctacctggccgatgagatcctgtggggccagcgctttgtgcccattgtagct
gaggaggacggacgttactctgtggactactccaagtttggcaacaccgtcaaagtgccc
acaccactctgcacggcccgccagcttgatgaggaccacagcctactggaagctctgacc
ctcgcctcagcccgcgggcccctgcgcaagcgcagcgtgcccatggccaaggccaagccc
aagttcagcatctctccagattccctgtcctga

DBGET integrated database retrieval system