KEGG   Homo sapiens (human): 5515
Entry
5515              CDS       T01001                                 
Symbol
PPP2CA, HJS3, NEDLBA, PP2Ac, PP2CA, PP2Calpha, RP-C
Name
(RefSeq) protein phosphatase 2 catalytic subunit alpha
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Disease
H02632  PP2A-related neurodevelopmental disorder
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5515 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5515 (PPP2CA)
   04390 Hippo signaling pathway
    5515 (PPP2CA)
   04071 Sphingolipid signaling pathway
    5515 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    5515 (PPP2CA)
   04152 AMPK signaling pathway
    5515 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5515 (PPP2CA)
   04136 Autophagy - other
    5515 (PPP2CA)
  09143 Cell growth and death
   04110 Cell cycle
    5515 (PPP2CA)
   04114 Oocyte meiosis
    5515 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5515 (PPP2CA)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5515 (PPP2CA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5515 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    5515 (PPP2CA)
   04730 Long-term depression
    5515 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5515 (PPP2CA)
   05165 Human papillomavirus infection
    5515 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5515 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5515 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5515 (PPP2CA)
   04131 Membrane trafficking [BR:hsa04131]
    5515 (PPP2CA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5515 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5515 (PPP2CA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5515 (PPP2CA)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5515 (PPP2CA)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5515 (PPP2CA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5515 (PPP2CA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5515 (PPP2CA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5515 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N zf-TAZ Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 5515
NCBI-ProteinID: NP_002706
OMIM: 176915
HGNC: 9299
Ensembl: ENSG00000113575
LinkDB
Position
5:complement(134194332..134226073)
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaggttcgatgtccagttactgtctgtggagatgtgcatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagatacaaattac
ttgtttatgggagattatgttgacagaggatattattcagttgaaacagttacactgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgagggaatcatgagagc
agacagatcacacaagtttatggtttctatgatgaatgtttaagaaaatatggaaatgca
aatgtttggaaatattttacagatctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacatggtggtctctcgccatctatagatacactggatcatatc
agagcacttgatcgcctacaagaagttccccatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggttggggtatatctcctcgaggagctggttacaccttt
gggcaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtctagagct
caccagctagtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaaccaagctgcaatcatggaacttgacgat
actctaaaatactctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Homo sapiens (human): 5516
Entry
5516              CDS       T01001                                 
Symbol
PPP2CB, PP2Abeta, PP2CB
Name
(RefSeq) protein phosphatase 2 catalytic subunit beta
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Drug target
Fostriecin sodium: D04262
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5516 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5516 (PPP2CB)
   04390 Hippo signaling pathway
    5516 (PPP2CB)
   04071 Sphingolipid signaling pathway
    5516 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    5516 (PPP2CB)
   04152 AMPK signaling pathway
    5516 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    5516 (PPP2CB)
   04136 Autophagy - other
    5516 (PPP2CB)
  09143 Cell growth and death
   04110 Cell cycle
    5516 (PPP2CB)
   04114 Oocyte meiosis
    5516 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5516 (PPP2CB)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5516 (PPP2CB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5516 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    5516 (PPP2CB)
   04730 Long-term depression
    5516 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5516 (PPP2CB)
   05165 Human papillomavirus infection
    5516 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5516 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5516 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5516 (PPP2CB)
   04131 Membrane trafficking [BR:hsa04131]
    5516 (PPP2CB)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5516 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5516 (PPP2CB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     5516 (PPP2CB)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     5516 (PPP2CB)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5516 (PPP2CB)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    5516 (PPP2CB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5516 (PPP2CB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   5516 (PPP2CB)
SSDB
Motif
Pfam: Metallophos STPPase_N zf-TAZ Glyco_hydro_65N
Other DBs
NCBI-GeneID: 5516
NCBI-ProteinID: NP_001009552
OMIM: 176916
HGNC: 9300
Ensembl: ENSG00000104695
LinkDB
Position
8:complement(30785616..30812818)
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtcgagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggcaaaggaaattttaaca
aaagaatcaaatgtgcaagaggttcgttgccctgttactgtctgtggagatgtgcatggt
caatttcatgatcttatggaactctttagaattggtggaaaatcaccggatacaaactac
ttattcatgggtgactatgtagacagaggatattattcagtggagactgtgactcttctt
gtagcattaaaggtgcgttatccagaacgcattacaatattgagaggaaatcacgaaagc
cgacaaattacccaagtatatggcttttatgatgaatgtctgcgaaagtatgggaatgcc
aacgtttggaaatattttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccatggtggcctctctccatccatagacacactggatcatata
agagccctggatcgtttacaggaagttccacatgagggcccaatgtgtgatctgttatgg
tcagatccagatgatcgtggtggatggggtatttcaccacgtggtgctggctacacattt
ggacaagacatttctgaaacctttaaccatgccaatggtctcacactggtttctcgtgcc
caccagcttgtaatggagggatacaattggtgtcatgatcggaatgtggttaccattttc
agtgcacccaattactgttatcgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattccttccttcaatttgacccagcgcctcgtcgtggtgagcctcatgtt
acacggcgcaccccagactacttcctataa

KEGG   Homo sapiens (human): 5518
Entry
5518              CDS       T01001                                 
Symbol
PPP2R1A, HJS2, MRD36, PP2A-Aalpha, PP2AA, PP2AAALPHA, PR65A
Name
(RefSeq) protein phosphatase 2 scaffold subunit Aalpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Disease
H00773  Autosomal dominant intellectual developmental disorder
H02632  PP2A-related neurodevelopmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5518 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5518 (PPP2R1A)
   04390 Hippo signaling pathway
    5518 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    5518 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    5518 (PPP2R1A)
   04152 AMPK signaling pathway
    5518 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5518 (PPP2R1A)
   04114 Oocyte meiosis
    5518 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5518 (PPP2R1A)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5518 (PPP2R1A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5518 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5518 (PPP2R1A)
   04730 Long-term depression
    5518 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5518 (PPP2R1A)
   05165 Human papillomavirus infection
    5518 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5518 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5518 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5518 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5518 (PPP2R1A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5518 (PPP2R1A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5518 (PPP2R1A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5518 (PPP2R1A)
SSDB
Motif
Pfam: HEAT PPP2R1A-like_HEAT HEAT_2 Vac14_Fab1_bd Htt_N-HEAT_1 HEAT_EZ PDS5 Cnd1 CLASP_N Adaptin_N M11L
Other DBs
NCBI-GeneID: 5518
NCBI-ProteinID: NP_055040
OMIM: 605983
HGNC: 9302
Ensembl: ENSG00000105568
LinkDB
Position
19:52190052..52229518
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggcgacgactcgctgtaccccatcgcggtgctcatagacgaactc
cgcaatgaggacgttcagcttcgcctcaacagcatcaagaagctgtccaccatcgccttg
gcccttggggttgaaaggacccgaagtgagcttctgcctttccttacagataccatctat
gatgaagatgaggtcctcctggccctggcagaacagctgggaaccttcactaccctggtg
ggaggcccagagtacgtgcactgcctgctgccaccgctggagtcgctggccacagtggag
gagacagtggtgcgggacaaggcagtggagtccttacgggccatctcacacgagcactcg
ccctctgacctggaggcgcactttgtgccgctagtgaagcggctggcgggcggcgactgg
ttcacctcccgcacctcggcctgcggcctcttctccgtctgctacccccgagtgtccagt
gctgtgaaggcggaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaagctgggggagtttgccaaggtgctggagctggacaac
gtcaagagtgagatcatccccatgttctccaacctggcctctgacgagcaggactcggtg
cggctgctggcggtggaggcgtgcgtgaacatcgcccagcttctgccccaggaggatctg
gaggccctggtgatgcccactctgcgccaggccgctgaagacaagtcctggcgcgtccgc
tacatggtggctgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagacctggtccctgccttccagaacctgatgaaagactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaacctctcagctgactgtcgggagaat
gtgatcatgtcccagatcttgccctgcatcaaggagctggtgtccgatgccaaccaacat
gtcaagtctgccctggcctcagtcatcatgggtctctctcccatcttgggcaaagacaac
accatcgagcacctcttgcccctcttcctggctcagctgaaggatgagtgccctgaggta
cggctgaacatcatctctaacctggactgtgtgaacgaggtgattggcatccggcagctg
tcccagtccctgctccctgccattgtggagctggctgaggacgccaagtggcgggtgcgg
ctggccatcattgagtacatgcccctcctggctggacagctgggagtggagttctttgat
gagaaacttaactccttgtgcatggcctggcttgtggatcatgtatatgccatccgcgag
gcagccaccagcaacctgaagaagctagtggaaaagtttgggaaggagtgggcccatgcc
acaatcatccccaaggtcttggccatgtccggagaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctgtctgaggtctgtgggcaggacatcaccaccaagcac
atgctacccacggttctgcgcatggctggggacccggttgccaatgtccgcttcaatgtg
gccaagtctctgcagaagatagggcccatcctggacaacagcaccttgcagagtgaagtc
aagcccatcctagagaagctgacccaggaccaggatgtggacgtcaaatactttgcccag
gaggctctgactgttctgtctctcgcctga

KEGG   Homo sapiens (human): 5519
Entry
5519              CDS       T01001                                 
Symbol
PPP2R1B, PP2A-Abeta, PR65B
Name
(RefSeq) protein phosphatase 2 scaffold subunit Abeta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04530  Tight junction
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05142  Chagas disease
hsa05160  Hepatitis C
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Disease
H00013  Small cell lung cancer
H00014  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5519 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    5519 (PPP2R1B)
   04390 Hippo signaling pathway
    5519 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    5519 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    5519 (PPP2R1B)
   04152 AMPK signaling pathway
    5519 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5519 (PPP2R1B)
   04114 Oocyte meiosis
    5519 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5519 (PPP2R1B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5519 (PPP2R1B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5519 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5519 (PPP2R1B)
   04730 Long-term depression
    5519 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    5519 (PPP2R1B)
   05165 Human papillomavirus infection
    5519 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    5519 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5519 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5519 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5519 (PPP2R1B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5519 (PPP2R1B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5519 (PPP2R1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5519 (PPP2R1B)
SSDB
Motif
Pfam: HEAT PPP2R1A-like_HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N Htt_N-HEAT_1 PDS5 SCD M11L CLASP_N
Other DBs
NCBI-GeneID: 5519
NCBI-ProteinID: NP_002707
OMIM: 603113
HGNC: 9303
Ensembl: ENSG00000137713
LinkDB
Position
11:complement(111688000..111766389)
AA seq 601 aa
MAGASELGTGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
SELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLENLATVEETVVRDKA
VESLRQISQEHTPVALEAYFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
QFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTSLASDEQDSVRLLAVEAC
VSIAQLLSQDDLETLVMPTLRQAAEDKSWRVRYMVADRFSELQKAMGPKITLNDLIPAFQ
NLLKDCEAEVRAAAAHKVKELGENLPIEDRETIIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTILGKENTIEHLLPLFLAQLKDECPDVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGQEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgcatcagagctcgggaccggcccaggagcagcgggtggagatggagatgat
tcgctatacccgatcgcggttttaatcgacgagctccgcaatgaagacgtgcagctccga
ctcaacagtattaagaagttatcaacaattgccctagcacttggagtagaaaggacccga
agtgaattgttgccatttcttacagatacaatttatgatgaagatgaggtactattagct
cttgctgagcagctgggaaatttcactggcctagtgggaggtcctgactttgcccactgt
ctgctgcctcctttggaaaatctggcaactgtggaagagactgttgttcgtgacaaggct
gtggagtccctgagacagatctcccaggagcatactcctgttgctctggaagcttatttt
gtacctctggtgaaacgcttagcaagtggggattggttcacctctcgcacatctgcatgt
ggtttgttcagcgtttgctatcccagggcatcaaatgctgttaaagcagaaatcagacag
caattccgttccttgtgctcagatgacacaccaatggtacgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccactg
ttcactagtctagcttcagatgaacaggattcagtgcgcctccttgctgtggaagcttgt
gtcagtattgcccagttattgtctcaggatgaccttgagactttggtgatgcctacactt
cgacaagcagcagaagataaatcttggcgcgttcgctatatggtggctgacagattttca
gagctccagaaagccatgggtcctaaaatcaccctaaatgacctcatccccgcctttcag
aacctacttaaagactgtgaagctgaagtccgggcagctgctgcccacaaagtaaaagaa
cttggtgagaacttgcccattgaagatagagagaccataattatgaatcaaattctgcct
tatataaaggaattagtatccgataccaatcaacatgtcaaatcggctctagcttctgta
attatgggattgtctactattttgggcaaagaaaataccattgaacatcttctacctctt
ttcttagctcagttaaaggatgagtgtcctgacgttcgtttgaatatcatctccaatttg
gattgtgtaaatgaagtgattggaatccgtcagctctctcagtctctccttcctgccata
gtggagctggcagaagatgccaaatggagggtccgcctggccatcattgagtatatgccg
ctgctggcaggccagctgggtgtggaattctttgatgaaaagctgaattctttatgtatg
gcttggctcgtggaccatgtatacgccatccgagaagctgccaccaacaacctcatgaaa
ctagttcagaagtttggtacagagtgggcccaaaatactattgttcccaaagtgttagta
atggcaaatgatcctaattacttgcatagaatgaccactttattctgcattaatgcactg
tctgaggcctgtggtcaggaaataactactaagcaaatgctgcccatcgtattaaaaatg
gcaggagaccaagtagcaaatgttcgcttcaatgtggccaaatctctacaaaagattgga
ccaattctagataccaatgctttacagggagaagtgaagccagtactacagaagttaggt
caagatgaagacatggatgtcaaatactttgcacaggaagctataagtgttcttgcattg
gcataa

KEGG   Homo sapiens (human): 5525
Entry
5525              CDS       T01001                                 
Symbol
PPP2R5A, B56A, B56alpha, PR61A
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'alpha
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5525 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5525 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    5525 (PPP2R5A)
   04152 AMPK signaling pathway
    5525 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5525 (PPP2R5A)
   04114 Oocyte meiosis
    5525 (PPP2R5A)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5525 (PPP2R5A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5525 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    5525 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5525 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5525 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5525 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5525 (PPP2R5A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5525 (PPP2R5A)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5525 (PPP2R5A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5525 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 5525
NCBI-ProteinID: NP_006234
OMIM: 601643
HGNC: 9309
Ensembl: ENSG00000066027
LinkDB
Position
1:212285410..212361853
AA seq 486 aa
MSSSSPPAGAASAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAELHPLPQLK
DATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRGVIVESAY
SDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESPDFQPSIA
KRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIFLRFIYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLAYCVVQFL
EKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLFKQISKCV
SSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFASLYKISKEHWNPTIVALVYNVLK
TLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSAYNMHSIL
SNTSAE
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgccgccggcgggggctgccagcgccgccatctcggcctcggagaaa
gtggacggcttcacccggaaatcggtccgcaaggcgcagaggcagaagcgctcccagggc
tcgtcgcagtttcgcagccagggcagccaggcagagctgcacccgctgccccagctcaaa
gatgccacttcaaatgaacaacaagagcttttctgtcagaagttgcagcagtgttgtata
ctgtttgatttcatggactctgtttcagacttgaagagcaaagaaattaaaagagcaaca
ctgaatgaactggttgagtatgtttcaactaatcgtggtgtaattgttgaatcagcgtat
tctgatatagtaaaaatgatcagtgctaacatcttccgtacacttcctccaagtgataat
ccagattttgatccagaagaggatgaacccacgcttgaggcctcttggcctcacatacag
ttggtatatgaattcttcttgagatttttggagagccctgatttccagcctagcattgca
aaacgatacattgatcagaaattcgtacaacagctcctggagctttttgatagtgaagat
cccagagaacgtgacttcctgaagactgttctgcaccgaatttatgggaaatttcttgga
ttaagagcattcatcagaaaacaaattaacaacattttcctcaggtttatatatgaaaca
gaacatttcaatggtgttgctgaacttcttgaaatattaggaagtattatcaatggcttt
gcattgccactgaaagcagaacataaacaatttctaatgaaggttcttattcctatgcat
actgcaaaaggattagctttgtttcatgctcagctagcatattgtgttgtacagttcctg
gagaaagatacaacactaacagagccagtgatcagaggactgctgaaattttggccaaaa
acctgcagtcagaaagaggtgatgtttttaggagaaattgaagaaatcttagatgtcatt
gaaccaacacagttcaaaaaaattgaagagccacttttcaagcagatatccaagtgtgta
tccagttctcattttcaggttgcagaaagggcattgtacttctggaataacgaatatatt
cttagtttgattgaggagaacattgataaaattctgccaattatgtttgccagtttgtac
aaaatttccaaagaacactggaatccgaccattgtagcactggtatacaatgtgctgaaa
accctaatggaaatgaatggcaagcttttcgatgaccttactagctcatacaaagctgaa
agacagagagagaaaaagaaggaattggaacgtgaagaattatggaaaaaattagaggag
ctaaagctaaagaaagctctagaaaaacagaatagtgcttacaacatgcacagtattctc
agcaatacaagtgccgaataa

KEGG   Homo sapiens (human): 5526
Entry
5526              CDS       T01001                                 
Symbol
PPP2R5B, B56B, B56beta, PR61B
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'beta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5526 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5526 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    5526 (PPP2R5B)
   04152 AMPK signaling pathway
    5526 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5526 (PPP2R5B)
   04114 Oocyte meiosis
    5526 (PPP2R5B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5526 (PPP2R5B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5526 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    5526 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5526 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5526 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5526 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5526 (PPP2R5B)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5526 (PPP2R5B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5526 (PPP2R5B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5526 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 5526
NCBI-ProteinID: NP_006235
OMIM: 601644
HGNC: 9310
Ensembl: ENSG00000068971
LinkDB
Position
11:64917573..64934475
AA seq 497 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCNHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVIRGLLKYWPKTCTQKEVMFLGEMEEILDVIEPSQFVKIQEPLFK
QVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHTVLPAVFGTLYQVSKEHWNQTIVSL
IYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKAQERQELWQGLEELRLRRLQGTQGAKE
APLQRLTPQVAASGGQS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggagacgaagctgccccctgcaagcacccccactagcccctcctcccccgggctgtcg
cctgtgcccccacccgacaaggtggacggcttctcccgccgttccctccgcagagcccgg
ccccgccgctcccacagctcctctcagttccgctatcagagcaaccagcaagagctcaca
ccgctgcccctgctcaaagatgtgccggcttccgagctgcacgagctgctgagccggaag
ctggcccagtgtggggtgatgtttgacttcttggactgtgtggccgacctcaaggggaag
gaggtgaagcgggcagccctcaacgagctggtggagtgtgtggggagcacccggggtgtc
ctcatcgagcccgtctacccagacatcatccgcatgatctcagtgaatatcttccggact
ctgccgcccagtgagaaccctgaatttgaccctgaagaggatgagcccaatcttgagcct
tcgtggccacacctgcagctggtatatgagtttttcctgcgtttcttggagagcccagac
ttccagccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctatttgatagtgaggatccccgggagcgtgagtacctcaagaccatcctgcaccgggtc
tatggcaagttcctgggtctccgggcctacatccgcaaacagtgcaaccacatcttcctc
cggttcatctatgaattcgagcacttcaatggtgtggctgagctgctggagatcctagga
agcatcatcaatggctttgcgctgcccctgaagacggagcacaagcagttcctggttcgc
gtcctgatccccctgcactctgtcaagtcgctgtctgtcttccatgcccagctggcatac
tgtgtggtgcagttcctggagaaggatgccactctgacagagcacgtgatccgggggctg
ctcaaatactggccaaaaacctgcacccagaaggaggtgatgtttctgggggagatggaa
gagattcttgatgtcatcgagccctcccagtttgtgaagatccaggagcccctttttaag
caggtggctcgctgtgtttccagcccccatttccaggttgcagagcgggctctgtatttc
tggaacaatgagtatatcctaagcctcattgaggacaactgccacactgtgctgcctgct
gtgtttgggaccctctaccaagtctccaaggagcactggaaccaaaccatcgtatcactg
atctacaatgtgctcaagaccttcatggagatgaatgggaagctgtttgatgagctcaca
gcctcctacaagctggaaaagcagcaggagcagcagaaggcccaggagcgtcaggagtta
tggcaaggtctggaggagctgcggctacgccggctacaggggacccagggggccaaggag
gcccccctccagcggcttacaccccaggtggccgccagtgggggtcagagctag

KEGG   Homo sapiens (human): 5527
Entry
5527              CDS       T01001                                 
Symbol
PPP2R5C, B56G, B56gamma, PR61G
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'gamma
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5527 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5527 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    5527 (PPP2R5C)
   04152 AMPK signaling pathway
    5527 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5527 (PPP2R5C)
   04114 Oocyte meiosis
    5527 (PPP2R5C)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5527 (PPP2R5C)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5527 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    5527 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5527 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5527 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5527 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5527 (PPP2R5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5527 (PPP2R5C)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5527 (PPP2R5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5527 (PPP2R5C)
SSDB
Motif
Pfam: B56 MvaI_BcnI
Other DBs
NCBI-GeneID: 5527
NCBI-ProteinID: NP_002710
OMIM: 601645
HGNC: 9311
Ensembl: ENSG00000078304
LinkDB
Position
14:101760573..101927992
AA seq 524 aa
MLTCNKAGSRMVVDAANSNGPFQPVVLLHIRDVPPADQEKLFIQKLRQCCVLFDFVSDPL
SDLKWKEVKRAALSEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDP
EEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERD
FLKTTLHRIYGKFLGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLK
EEHKIFLLKVLLPLHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPK
EVMFLNELEEILDVIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLIS
DNAAKILPIMFPSLYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEK
LKMKEREEAWVKIENLAKANPQYTVYSQASTMSIPVAMETDGPLFEDVQMLRKTVKDEAH
QAQKDPKKDRPLARRKSELPQDPHTKKALEAHCRADELASQDGR
NT seq 1575 nt   +upstreamnt  +downstreamnt
atgttgacatgtaataaagcgggcagcaggatggtggtggatgcggccaactccaatggg
cctttccagcccgtggtccttctccatattcgagatgttcctcctgctgatcaagagaag
ctttttatccagaagttacgtcagtgttgcgtcctctttgactttgtttctgatccacta
agtgacctaaagtggaaggaagtaaaacgagctgctttaagtgaaatggtagaatatatc
acccataatcggaatgtgatcacagagcctatttacccagaagtagtccatatgtttgca
gttaacatgtttcgaacattaccaccttcctccaatcctacgggagcggaatttgacccg
gaggaagatgaaccaacgttagaagcagcctggcctcatctacagcttgtttatgaattt
ttcttaagatttttagagtctccagatttccaacctaatatagcgaagaaatatattgat
cagaagtttgtattgcagcttttagagctctttgacagtgaagatcctcgggagagagat
tttcttaaaaccacccttcacagaatctatgggaaattcctaggcttgagagcttacatc
agaaaacagataaataatatattttataggtttatttatgaaacagagcatcataatggc
atagcagagttactggaaatattgggaagtataattaatggatttgccttaccactaaaa
gaagagcacaagattttcttattgaaggtgttactacctttgcacaaagtgaaatctctg
agtgtctaccatccccagctggcatactgtgtagtgcagtttttagaaaaggacagcacc
ctcacggaaccagtggtgatggcacttctcaaatactggccaaagactcacagtccaaaa
gaagtaatgttcttaaacgaattagaagagattttagatgtcattgaaccatcagaattt
gtgaagatcatggaacccctcttccggcagttggccaaatgtgtctccagcccacacttc
caggtggcagagcgagctctctattactggaataatgaatacatcatgagtttaatcagt
gacaacgcagcgaagattctgcccatcatgtttccttccttgtaccgcaactcaaagacc
cattggaacaagacaatacatggcttgatatacaacgccctgaagctcttcatggagatg
aaccaaaagctatttgatgactgtacacaacagttcaaagcagagaaactaaaagagaag
ctaaaaatgaaagaacgggaagaagcatgggttaaaatagaaaatctagccaaagccaat
ccccagtacacagtgtatagtcaagccagcaccatgagcattccggttgcaatggagaca
gatgggcctttatttgaagatgtgcagatgctgagaaagacagtgaaggacgaggctcat
caggcacagaaagatccgaagaaggaccgtcctcttgcacgccgcaagtccgagctgcct
caggacccccacaccaagaaagccttggaagctcactgcagggccgatgagctggcctcc
caggacggccgctag

KEGG   Homo sapiens (human): 5528
Entry
5528              CDS       T01001                                 
Symbol
PPP2R5D, B56D, B56delta, HJS1, MRD35
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'delta
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Disease
H00773  Autosomal dominant intellectual developmental disorder
H02632  PP2A-related neurodevelopmental disorder
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5528 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5528 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    5528 (PPP2R5D)
   04152 AMPK signaling pathway
    5528 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5528 (PPP2R5D)
   04114 Oocyte meiosis
    5528 (PPP2R5D)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5528 (PPP2R5D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5528 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    5528 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5528 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5528 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5528 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5528 (PPP2R5D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5528 (PPP2R5D)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5528 (PPP2R5D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5528 (PPP2R5D)
SSDB
Motif
Pfam: B56 PF0095-like_C
Other DBs
NCBI-GeneID: 5528
NCBI-ProteinID: NP_006236
OMIM: 601646
HGNC: 9312
Ensembl: ENSG00000112640
LinkDB
Position
6:42984570..43012342
AA seq 602 aa
MPYKLKKEKEPPKVAKCTAKPSSSGKDGGGENTEEAQPQPQPQPQPQAQSQPPSSNKRPS
NSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELFIQ
KLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVNLF
RTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQKFV
LALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIAEL
LEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLTEP
VIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQVAE
RALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQKL
FDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPT
AEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQE
AL
NT seq 1809 nt   +upstreamnt  +downstreamnt
atgccctataaactgaaaaaggagaaggagccccccaaggttgccaaatgcacagccaag
cctagcagctcgggcaaggatggtggaggcgagaacactgaggaggcccagccgcagccc
cagccccagccccagccccaagcccagtctcagccaccgtcatccaacaagcgtcccagc
aatagcacgccgccccccacgcagctcagcaaaatcaagtactcaggggggccccagatt
gtcaagaaggagcgacggcaaagctcctcccgcttcaacctcagcaagaatcgggagctg
cagaagcttcctgccctgaaagattcgccaacccaggagcgggaggagctgtttatccag
aagctacgccagtgctgtgtcctctttgacttcgtgtcagacccactcagtgacctcaaa
ttcaaggaggtgaagcgggcaggactcaacgagatggtggagtacatcacccatagccgt
gatgttgtcactgaggccatttaccctgaggctgtcaccatgttttcagtgaacctcttc
cggacgctgccaccttcatcgaatcccacaggggctgagtttgacccagaggaagatgag
cccaccctggaagctgcttggccacatctccagctcgtgtatgagttcttcttacgtttc
cttgagtctcctgatttccagccaaacatagccaagaagtacatcgaccagaagtttgta
cttgctctcctagacctatttgacagtgaggatcctcgagagcgggacttcctcaagacc
attttgcatcgcatctatggcaagtttttggggctccgggcttatatccgtaggcagatc
aaccacatcttctacaggttcatctacgagacggagcatcacaacgggattgctgagctc
ctggagatcctgggcagcatcatcaatggctttgccctgccccttaaagaagagcacaag
atgttcctcatccgtgtcctacttccccttcacaaggtcaagtccctgagtgtctaccac
cctcagctggcatactgtgtggtacaattcctggagaaggagagcagtctgactgagccg
gtaattgtgggacttctcaagttttggcccaagacccacagccccaaggaggtgatgttc
ttgaatgagctggaggagattctggacgtcattgaaccttctgagttcagcaaagtgatg
gaacccctcttccgccagctggccaagtgtgtctctagcccccatttccaggtggcagag
cgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaatgctgcc
cgagtcctccccatcatgttccctgcactctacaggaactccaagagccactggaacaag
acaatccatggactgatctataatgccctgaagttgtttatggaaatgaatcagaagctg
tttgatgactgcacacaacaatacaaggcagagaagcagaagggccggttccgaatgaag
gaaagggaagagatgtggcaaaaaatcgaggagctggcccggcttaatccccagtatccc
atgttccgagcccctccaccactgccccctgtgtactcgatggagacagagacccccaca
gctgaggacatccagcttctgaagaggactgtggagactgaggctgttcagatgctaaaa
gacatcaagaaggagaaagtgctgctgcggaggaagtcggagctgccccaggacgtgtac
accatcaaggcactggaggcgcacaagcgggcggaagagttcctaactgccagccaggag
gctctctga

KEGG   Homo sapiens (human): 5529
Entry
5529              CDS       T01001                                 
Symbol
PPP2R5E, B56E, B56epsilon
Name
(RefSeq) protein phosphatase 2 regulatory subunit B'epsilon
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
hsa  Homo sapiens (human)
Pathway
hsa03015  mRNA surveillance pathway
hsa04071  Sphingolipid signaling pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04660  T cell receptor signaling pathway
hsa04728  Dopaminergic synapse
hsa05165  Human papillomavirus infection
Network
nt06166  Human papillomavirus (HPV)
nt06512  Chromosome cohesion and segregation
nt06530  PI3K signaling
nt06537  TCR/BCR signaling
  Element
N00355  PP2A-AKT signaling pathway
N00356  HPV E7 to PP2A-AKT signaling patyway
N01485  Cohesin dissociation in prophase
N01497  Condensin loading
N01579  CD80/CD86-CTLA4-PP2A signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    5529 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    5529 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    5529 (PPP2R5E)
   04152 AMPK signaling pathway
    5529 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    5529 (PPP2R5E)
   04114 Oocyte meiosis
    5529 (PPP2R5E)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    5529 (PPP2R5E)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    5529 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    5529 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    5529 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5529 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    5529 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:hsa03036]
    5529 (PPP2R5E)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     5529 (PPP2R5E)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     5529 (PPP2R5E)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     5529 (PPP2R5E)
SSDB
Motif
Pfam: B56 DUF6483 SBF2 Sec7-like_HUS
Other DBs
NCBI-GeneID: 5529
NCBI-ProteinID: NP_001269108
OMIM: 601647
HGNC: 9313
Ensembl: ENSG00000154001
LinkDB
Position
14:complement(63371364..63543377)
AA seq 467 aa
MSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLKDVPSSEQP
ELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTYPEVVRMVS
CNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIAKKYIDQKF
VLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYETEHFNGVAE
LLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFLEKDPSLTE
PVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCVSSPHFQVA
ERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLKAFMEMNST
MFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcctcagcaccaactactcctccatcagtggataaagtagacggattttctcggaag
tccgtcagaaaagccagacagaagaggtcgcaaagttcctcacagtttaggtctcaaggc
aagcctattgagttaacacctctgccgctgctaaaagacgttccatcctcagagcagcct
gaactgttcctaaagaaacttcagcagtgctgtgtcatttttgacttcatggacacgcta
tctgatcttaaaatgaaagaatacaagcgctccactcttaatgaactggtggactacatt
acaataagcagaggctgtttgacagagcagacttaccctgaagtagttagaatggtatct
tgcaatatattcagaactctccctcctagtgacagcaatgaatttgatccagaagaagat
gaacctacccttgaggcatcgtggccacacttacagcttgtatatgaatttttcatacga
tttttggaaagccaagaattccaacccagcattgccaaaaaatatatagatcagaaattt
gtattacagcttctggagctatttgacagcgaagaccctcgggaacgggactacttaaaa
acagtcttacacagaatttatggcaagtttcttggtcttagagcatttatccgaaaacag
attaacaatatttttctaaggtttgtttatgaaacagaacacttcaatggtgtagctgaa
ctgctggaaatattaggaagtattatcaatggctttgctttacctcttaaggcagaacac
aaacagtttctggtgaaagtattgatccctttacacactgtcaggagcttatcactcttc
catgcacagctggcatattgtatagtacagtttctggagaaagatccttcactcacagaa
ccagttattagggggttaatgaaattttggcctaaaacatgtagtcaaaaagaggtcatg
ttccttggggaactggaagaaatattggatgtgattgaaccttcacaatttgttaaaatc
caagaacctttgtttaaacaaatcgccaagtgtgtatctagcccccattttcaggtggca
gaaagagcactctattattggaataatgaatacatcatgagtttgatagaagaaaactct
aacgtcatccttcccatcatgttttccagcctttataggatttcaaaagaacattggaat
ccggctattgtggcgttggtgtacaatgtgttgaaggcatttatggaaatgaacagcacc
atgtttgacgagctgacagccacatacaagtcagatcgtcagcgtgagaaaaagaaagaa
aaggagcgtgaagaattgtggaaaaaattggaggatctggagttaaagagaggtcttaga
cgtgatggaataattccaacttaa

DBGET integrated database retrieval system