KEGG   Homo sapiens (human): 5979
Entry
5979              CDS       T01001                                 
Symbol
RET, CDHF12, CDHR16, HSCR1, MEN2A, MEN2B, MTC1, PTC, RET-ELE1
Name
(RefSeq) ret proto-oncogene
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa05200  Pathways in cancer
hsa05216  Thyroid cancer
hsa05223  Non-small cell lung cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06266  Non-small cell lung cancer
nt06274  Thyroid cancer
  Element
N00008  RET fusion kinase to RAS-ERK signaling pathway
N01064  Mutation-activated RET to RAS-ERK signaling pathway
N01065  Mutation-activated RET to PI3K signaling pathway
N10025  Tyrosine kinase inhibitor to RET fusion
Disease
H00014  Non-small cell lung cancer
H00032  Thyroid cancer
H00247  Multiple endocrine neoplasia syndrome
H00910  Hirschsprung disease
H01510  Malignant paraganglioma
H01592  Medullary thyroid cancer
Drug target
Lenvatinib (DG01362): D09919 D09920<JP/US>
Motesanib (DG01262): D06678 D08947
Pralsetinib: D11712<US>
Pralsetinib (DG03223): D12354
Regorafenib (DG00720): D10137<JP/US> D10138
Selpercatinib: D11713<JP/US>
Sorafenib (DG00713): D06272<JP/US> D08524
Sunitinib (DG00712): D06402<JP/US> D08552
Vandetanib: D06407<JP/US>
Zeteletinib (DG03221): D12330 D12331
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    5979 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5979 (RET)
   05230 Central carbon metabolism in cancer
    5979 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    5979 (RET)
   05223 Non-small cell lung cancer
    5979 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5979 (RET)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     5979 (RET)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  RET family
   5979 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD1 RET_CLD3 RET_CLD4 Pkinase Cadherin RIO1 Pkinase_fungal Haspin_kinase ABC1
Other DBs
NCBI-GeneID: 5979
NCBI-ProteinID: NP_066124
OMIM: 164761
HGNC: 9967
Ensembl: ENSG00000165731
Vega: OTTHUMG00000018024
Pharos: P07949(Tclin)
UniProt: P07949 A0A024R7T2
Structure
LinkDB
Position
10:43077069..43130351
AA seq 1114 aa
MAKATSGAAGLRLLLLLLLPLLGKVALGLYFSRDAYWEKLYVDQAAGTPLLYVHALRDAP
EEVPSFRLGQHLYGTYRTRLHENNWICIQEDTGLLYLNRSLDHSSWEKLSVRNRGFPLLT
VYLKVFLSPTSLREGECQWPGCARVYFSFFNTSFPACSSLKPRELCFPETRPSFRIRENR
PPGTFHQFRLLPVQFLCPNISVAYRLLEGEGLPFRCAPDSLEVSTRWALDREQREKYELV
AVCTVHAGAREEVVMVPFPVTVYDEDDSAPTFPAGVDTASAVVEFKRKEDTVVATLRVFD
ADVVPASGELVRRYTSTLLPGDTWAQQTFRVEHWPNETSVQANGSFVRATVHDYRLVLNR
NLSISENRTMQLAVLVNDSDFQGPGAGVLLLHFNVSVLPVSLHLPSTYSLSVSRRARRFA
QIGKVCVENCQAFSGINVQYKLHSSGANCSTLGVVTSAEDTSGILFVNDTKALRRPKCAE
LHYMVVATDQQTSRQAQAQLLVTVEGSYVAEEAGCPLSCAVSKRRLECEECGGLGSPTGR
CEWRQGDGKGITRNFSTCSPSTKTCPDGHCDVVETQDINICPQDCLRGSIVGGHEPGEPR
GIKAGYGTCNCFPEEEKCFCEPEDIQDPLCDELCRTVIAAAVLFSFIVSVLLSAFCIHCY
HKFAHKPPISSAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQVSVDAFKILEDPKWEFP
RKNLVLGKTLGEGEFGKVVKATAFHLKGRAGYTTVAVKMLKENASPSELRDLLSEFNVLK
QVNHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRESRKVGPGYLGSGGSRNSSSLDH
PDERALTMGDLISFAWQISQGMQYLAEMKLVHRDLAARNILVAEGRKMKISDFGLSRDVY
EEDSYVKRSQGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIPPERL
FNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKRRDYLDLAA
STPSDSLIYDDGLSEEETPLVDCNNAPLPRALPSTWIENKLYGMSDPNWPGESPVPLTRA
DGTNTGFPRYPNDSVYANWMLSPSAAKLMDTFDS
NT seq 3345 nt   +upstreamnt  +downstreamnt
atggcgaaggcgacgtccggtgccgcggggctgcgtctgctgttgctgctgctgctgccg
ctgctaggcaaagtggcattgggcctctacttctcgagggatgcttactgggagaagctg
tatgtggaccaggcagccggcacgcccttgctgtacgtccatgccctgcgggacgcccct
gaggaggtgcccagcttccgcctgggccagcatctctacggcacgtaccgcacacggctg
catgagaacaactggatctgcatccaggaggacaccggcctcctctaccttaaccggagc
ctggaccatagctcctgggagaagctcagtgtccgcaaccgcggctttcccctgctcacc
gtctacctcaaggtcttcctgtcacccacatcccttcgtgagggcgagtgccagtggcca
ggctgtgcccgcgtatacttctccttcttcaacacctcctttccagcctgcagctccctc
aagccccgggagctctgcttcccagagacaaggccctccttccgcattcgggagaaccga
cccccaggcaccttccaccagttccgcctgctgcctgtgcagttcttgtgccccaacatc
agcgtggcctacaggctcctggagggtgagggtctgcccttccgctgcgccccggacagc
ctggaggtgagcacgcgctgggccctggaccgcgagcagcgggagaagtacgagctggtg
gccgtgtgcaccgtgcacgccggcgcgcgcgaggaggtggtgatggtgcccttcccggtg
accgtgtacgacgaggacgactcggcgcccaccttccccgcgggcgtcgacaccgccagc
gccgtggtggagttcaagcggaaggaggacaccgtggtggccacgctgcgtgtcttcgat
gcagacgtggtacctgcatcaggggagctggtgaggcggtacacaagcacgctgctcccc
ggggacacctgggcccagcagaccttccgggtggaacactggcccaacgagacctcggtc
caggccaacggcagcttcgtgcgggcgaccgtacatgactataggctggttctcaaccgg
aacctctccatctcggagaaccgcaccatgcagctggcggtgctggtcaatgactcagac
ttccagggcccaggagcgggcgtcctcttgctccacttcaacgtgtcggtgctgccggtc
agcctgcacctgcccagtacctactccctctccgtgagcaggagggctcgccgatttgcc
cagatcgggaaagtctgtgtggaaaactgccaggcattcagtggcatcaacgtccagtac
aagctgcattcctctggtgccaactgcagcacgctaggggtggtcacctcagccgaggac
acctcggggatcctgtttgtgaatgacaccaaggccctgcggcggcccaagtgtgccgaa
cttcactacatggtggtggccaccgaccagcagacctctaggcaggcccaggcccagctg
cttgtaacagtggaggggtcatatgtggccgaggaggcgggctgccccctgtcctgtgca
gtcagcaagagacggctggagtgtgaggagtgtggcggcctgggctccccaacaggcagg
tgtgagtggaggcaaggagatggcaaagggatcaccaggaacttctccacctgctctccc
agcaccaagacctgccccgacggccactgcgatgttgtggagacccaagacatcaacatt
tgccctcaggactgcctccggggcagcattgttgggggacacgagcctggggagccccgg
gggattaaagctggctatggcacctgcaactgcttccctgaggaggagaagtgcttctgc
gagcccgaagacatccaggatccactgtgcgacgagctgtgccgcacggtgatcgcagcc
gctgtcctcttctccttcatcgtctcggtgctgctgtctgccttctgcatccactgctac
cacaagtttgcccacaagccacccatctcctcagctgagatgaccttccggaggcccgcc
caggccttcccggtcagctactcctcttccggtgcccgccggccctcgctggactccatg
gagaaccaggtctccgtggatgccttcaagatcctggaggatccaaagtgggaattccct
cggaagaacttggttcttggaaaaactctaggagaaggcgaatttggaaaagtggtcaag
gcaacggccttccatctgaaaggcagagcagggtacaccacggtggccgtgaagatgctg
aaagagaacgcctccccgagtgagctgcgagacctgctgtcagagttcaacgtcctgaag
caggtcaaccacccacatgtcatcaaattgtatggggcctgcagccaggatggcccgctc
ctcctcatcgtggagtacgccaaatacggctccctgcggggcttcctccgcgagagccgc
aaagtggggcctggctacctgggcagtggaggcagccgcaactccagctccctggaccac
ccggatgagcgggccctcaccatgggcgacctcatctcatttgcctggcagatctcacag
gggatgcagtatctggccgagatgaagctcgttcatcgggacttggcagccagaaacatc
ctggtagctgaggggcggaagatgaagatttcggatttcggcttgtcccgagatgtttat
gaagaggattcctacgtgaagaggagccagggtcggattccagttaaatggatggcaatt
gaatccctttttgatcatatctacaccacgcaaagtgatgtatggtcttttggtgtcctg
ctgtgggagatcgtgaccctagggggaaacccctatcctgggattcctcctgagcggctc
ttcaaccttctgaagaccggccaccggatggagaggccagacaactgcagcgaggagatg
taccgcctgatgctgcaatgctggaagcaggagccggacaaaaggccggtgtttgcggac
atcagcaaagacctggagaagatgatggttaagaggagagactacttggaccttgcggcg
tccactccatctgactccctgatttatgacgacggcctctcagaggaggagacaccgctg
gtggactgtaataatgcccccctccctcgagccctcccttccacatggattgaaaacaaa
ctctatggcatgtcagacccgaactggcctggagagagtcctgtaccactcacgagagct
gatggcactaacactgggtttccaagatatccaaatgatagtgtatatgctaactggatg
ctttcaccctcagcggcaaaattaatggacacgtttgatagttaa

DBGET integrated database retrieval system