KEGG   Homo sapiens (human): 6391
Entry
6391              CDS       T01001                                 
Symbol
SDHC, CYB560, CYBL, PGL3, QPS1, SDH3
Name
(RefSeq) succinate dehydrogenase complex subunit C
  KO
K00236  succinate dehydrogenase (ubiquinone) cytochrome b560 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00988  Electron transfer in Complex II
N00989  Mutation-caused aberrant Htt to electron transfer in Complex II
N01392  Arsenic to electron transfer in complex II
N01393  Arsenic to electron transfer in complex II
N01402  Manganese to electron transfer in Complex II
Disease
H01510  Malignant paraganglioma
H01591  Gastrotintestinal stromal tumor
H02538  Paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6391 (SDHC)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6391 (SDHC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6391 (SDHC)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    6391 (SDHC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6391 (SDHC)
   05012 Parkinson disease
    6391 (SDHC)
   05014 Amyotrophic lateral sclerosis
    6391 (SDHC)
   05016 Huntington disease
    6391 (SDHC)
   05020 Prion disease
    6391 (SDHC)
   05022 Pathways of neurodegeneration - multiple diseases
    6391 (SDHC)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    6391 (SDHC)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    6391 (SDHC)
SSDB
Motif
Pfam: Sdh_cyt
Other DBs
NCBI-GeneID: 6391
NCBI-ProteinID: NP_002992
OMIM: 602413
HGNC: 10682
Ensembl: ENSG00000143252
Pharos: Q99643(Tbio)
UniProt: Q99643 A0A0S2Z4B7
LinkDB
Position
1:161314381..161375340
AA seq 169 aa
MAALLLRHVGRHCLRAHFSPQLCIRNAVPLGTTAKEEMERFWNKNIGSNRPLSPHITIYS
WSLPMAMSICHRGTGIALSAGVSLFGMSALLLPGNFESYLELVKSLCLGPALIHTAKFAL
VFPLMYHTWNGIRHLMWDLGKGLKIPQLYQSGVVVLVLTVLSSMGLAAM
NT seq 510 nt   +upstreamnt  +downstreamnt
atggctgcgctgttgctgagacacgttggtcgtcattgcctccgagcccactttagccct
cagctctgtatcagaaatgctgttcctttgggaaccacggccaaagaagagatggagcgg
ttctggaataagaatataggttcaaaccgtcctctgtctccccacattactatctacagt
tggtctcttcccatggcgatgtccatctgccaccgtggcactggtattgctttgagtgca
ggggtctctctttttggcatgtcggccctgttactccctgggaactttgagtcttatttg
gaacttgtgaagtccctgtgtctggggccagcactgatccacacagctaagtttgcactt
gtcttccctctcatgtatcatacctggaatgggatccgacacttgatgtgggacctagga
aaaggcctgaagattccccagctataccagtctggagtggttgtcctggttcttactgtg
ttgtcctctatggggctggcagccatgtga

DBGET integrated database retrieval system