KEGG   Homo sapiens (human): 6392
Entry
6392              CDS       T01001                                 
Symbol
SDHD, CBT1, CII-4, CWS3, MC2DN3, PGL, PGL1, QPs3, SDH4, cybS
Name
(RefSeq) succinate dehydrogenase complex subunit D
  KO
K00237  succinate dehydrogenase (ubiquinone) membrane anchor subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
hsa_M00148  Succinate dehydrogenase (ubiquinone)
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00988  Electron transfer in Complex II
N00989  Mutation-caused aberrant Htt to electron transfer in Complex II
N01392  Arsenic to electron transfer in complex II
N01393  Arsenic to electron transfer in complex II
N01402  Manganese to electron transfer in Complex II
Disease
H00034  Carcinoid
H01222  Cowden syndrome
H01510  Malignant paraganglioma
H02005  Mitochondrial complex II deficiency
H02538  Paraganglioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    6392 (SDHD)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    6392 (SDHD)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    6392 (SDHD)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    6392 (SDHD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    6392 (SDHD)
   05012 Parkinson disease
    6392 (SDHD)
   05014 Amyotrophic lateral sclerosis
    6392 (SDHD)
   05016 Huntington disease
    6392 (SDHD)
   05020 Prion disease
    6392 (SDHD)
   05022 Pathways of neurodegeneration - multiple diseases
    6392 (SDHD)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    6392 (SDHD)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    6392 (SDHD)
SSDB
Motif
Pfam: CybS Ldh_2
Other DBs
NCBI-GeneID: 6392
NCBI-ProteinID: NP_002993
OMIM: 602690
HGNC: 10683
Ensembl: ENSG00000204370
Pharos: O14521(Tbio)
UniProt: O14521 A0A0S2Z4J3
LinkDB
Position
11:112086873..112095794
AA seq 159 aa
MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPIPEWCGVQHIHLSPSHHSGSK
AASLHWTSERVVSVLLLGLLPAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL
QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
NT seq 480 nt   +upstreamnt  +downstreamnt
atggcggttctctggaggctgagtgccgtttgcggtgccctaggaggccgagctctgttg
cttcgaactccagtggtcagacctgctcatatctcagcatttcttcaggaccgacctatc
ccagaatggtgtggagtgcagcacatacacttgtcaccgagccaccattctggctccaag
gctgcatctctccactggactagcgagagggttgtcagtgttttgctcctgggtctgctt
ccggctgcttatttgaatccttgctctgcgatggactattccctggctgcagccctcact
cttcatggtcactggggccttggacaagttgttactgactatgttcatggggatgccttg
cagaaagctgccaaggcagggcttttggcactttcagctttaacctttgctgggctttgc
tatttcaactatcacgatgtgggcatctgcaaagctgttgccatgctgtggaagctctga

DBGET integrated database retrieval system