KEGG   Homo sapiens (human): 7094
Entry
7094              CDS       T01001                                 
Symbol
TLN1, ILWEQ, TLN, talin-1
Name
(RefSeq) talin 1
  KO
K06271  talin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa05131  Shigellosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    7094 (TLN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7094 (TLN1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    7094 (TLN1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7094 (TLN1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7094 (TLN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7094 (TLN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7094 (TLN1)
  Exosomal proteins of other cancer cells
   7094 (TLN1)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP TrcR GIT1_C RA DUF3025
Other DBs
NCBI-GeneID: 7094
NCBI-ProteinID: NP_006280
OMIM: 186745
HGNC: 11845
Ensembl: ENSG00000137076
Pharos: Q9Y490(Tbio)
UniProt: Q9Y490
Structure
LinkDB
Position
9:complement(35696948..35732195)
AA seq 2541 aa
MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGI
WLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIG
ITNHDEYSLVRELMEEKKEEITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTL
REQGVEEHETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAG
FQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVK
LARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQEWNLTNIKRWA
ASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQM
HRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESK
HEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLED
EGGSGRPLLQAAKGLAGAVSELLRSAQPASAEPRQNLLQAAGNVGQASGELLQQIGESDT
DPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQTQVIAAATQCALSTSQLVACT
KVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAAATAVTQALNE
LLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMA
TNAAAQNAIKKKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVA
EQIPLLVQGVRGSQAQPDSPSAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQL
SQCAKNLGTALAELRTAAQKAQEACGPLEMDSALSVVQNLEKDLQEVKAAARDGKLKPLP
GETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIAARDVAGGLRSLAQAARGVAA
LTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAKAVTQALNRCV
SCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAK
ALSTDPAAPNLKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENP
VQPINDMSYFGCLDSVMENSKVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAA
AQAAYLVGVSDPNSQAGQQGLVEPTQFARANQAIQMACQSLGEPGCTQAQVLSAATIVAK
HTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLVKTIKALDGAFTEENRAQCRA
ATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESAGGLIQTARAL
AVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEP
LTLAAVGAASKTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAV
QMMTEAVEDLTTTLNEAASAAGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRT
AKAIAVTVQEMVTKSNTSPEELGPLANQLTSDYGRLASEAKPAAVAAENEEIGSHIKHRV
QELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEKVSHVLAALQAGNRGTQACIT
AASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDTKVLVQNAAGS
QEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVF
CSPEPPAKTSTPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACK
EAAYHPEVAPDVRLRALHYGRECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSV
TELIQAAEAMKGTEWVDPEDPTVIAENELLGAAAAIEAAAKKLEQLKPRAKPKEADESLN
FEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIPANALDDGQWSQGLISAARMV
AAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDSEAMKRLQAAG
NAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK
KLAQIRQQQYKFLPSELRDEH
NT seq 7626 nt   +upstreamnt  +downstreamnt
atggttgcactttcactgaagatcagcattgggaatgtggtgaagacgatgcagtttgag
ccgtctaccatggtgtacgacgcctgccgcatcattcgtgagcggatcccagaggcccca
gctggtcctcccagcgactttgggctctttctgtcagatgatgaccccaaaaagggtata
tggctggaggctgggaaagctttggactactacatgctccgaaatggggacactatggag
tacaggaagaaacagagacccctgaagatccgtatgctggatggaactgtgaagacgatc
atggtggatgactctaagactgtcactgacatgctcatgaccatctgtgcccgcattggc
atcaccaatcatgatgaatattcattggttcgagagctgatggaagagaaaaaggaggaa
ataacagggaccttaagaaaggacaagacattgctgcgagatgaaaagaagatggagaaa
ctaaagcagaaattgcacacagatgatgagttgaactggctggaccatggtcggacactg
agggagcagggtgtagaggagcacgagacgctgctgctgcggaggaagttcttttactca
gaccagaatgtggattcccgggaccctgtacagctgaacctcctgtatgtgcaggcacga
gatgacatcctgaatggctcccaccctgtctcctttgacaaggcctgtgagtttgctggc
ttccaatgccagatccagtttgggccccacaatgagcagaagcacaaggctggcttcctt
gacctgaaggacttcctgcccaaggagtatgtgaagcagaagggagagcgtaagatcttc
caggcacacaagaattgtgggcagatgagtgagattgaggccaaggtccgctacgtgaag
ctagcccgttctctcaagacttacggtgtctccttcttcctggtgaaggaaaaaatgaaa
gggaagaacaagctagtgcccaggcttctgggcatcaccaaggagtgtgtgatgcgagtg
gatgagaagaccaaggaagtgatccaggagtggaacctcaccaacatcaaacgctgggct
gcgtctcccaaaagcttcaccctggattttggagattaccaagatggctattactcagta
cagacaactgaaggggagcagattgcacagctcattgccggctacatcgatatcatcctg
aagaagaaaaaaagcaaggatcactttgggctggaaggagatgaggagtctactatgctg
gaggactcagtgtcccccaaaaagtcaacagtcctgcagcagcaatacaaccgggtgggg
aaagtggagcatggctctgtggccctgcctgccatcatgcgctctggagcctctggtcct
gagaatttccaggtgggcagcatgccccctgcccagcagcagattaccagcggccagatg
caccgaggacacatgcctcctctgacttcagcccagcaggcactcactggaaccattaac
tccagcatgcaggccgtgcaggctgcccaggccaccctggatgactttgacactctgccg
cctcttggccaggatgctgcctctaaggcctggcgtaaaaacaagatggatgaatcaaag
catgagatccactctcaggtagatgccatcacagctggtactgcgtctgtggtgaacctg
acagcaggggaccctgctgagacagactataccgcagtgggctgtgcagtcaccacaatc
tcctccaacctgacggagatgtcccgtggggtgaagctgctggctgccttgctggaggac
gaaggcggcagtggtcggcccctgttgcaggcagcaaagggccttgcgggagcagtgtca
gaactgctgcgcagtgcccaaccagccagtgctgagccccgtcagaacctgctgcaagca
gctgggaacgtgggccaggccagtggggagctgttgcaacaaattggggaaagtgatact
gacccccacttccaggatgcgctaatgcagctcgccaaagctgtggcaagtgctgcagct
gccctggtcctcaaggccaagagtgtggcccagcggacagaggactcgggacttcagacc
caagttattgctgcagcaacacagtgtgccctatccacttcccaactagtggcctgtact
aaggtggtggcacctacaatcagctcacctgtctgccaagagcaactggtggaggctgga
cgactggtagccaaagccgtggagggctgtgtgtctgcctcccaggcagctacagaggat
gggcaactgttgcgaggggtaggagcagcagccacagctgtcacccaggccctaaatgag
ctgctgcagcatgtgaaagcccatgccacaggggctgggcctgctggccgttatgaccag
gctactgacaccatcctaaccgtcactgagaacatctttagctccatgggtgatgctggg
gagatggtgcgacaggcccgcatcctggcccaagccacatctgacctggtcaatgccatc
aaggctgatgctgagggggaaagtgatctggagaactcccgcaagctcttaagtgctgcc
aagatcctagctgatgccacagccaagatggtagaggctgccaagggagcagctgcccac
cctgacagtgaggagcagcagcagcggctgcgggaggcagctgaggggctgcgcatggcc
accaatgcagctgcgcagaatgccatcaagaaaaagctggtgcagcgcctggagcatgca
gccaagcaggctgcagcctcagccacacagaccatcgctgcagctcagcacgcagcctct
acccccaaggcctctgccggcccccagcccctgctggtgcagagctgcaaggcagtggca
gagcagattccactgctggtgcagggcgtccgaggaagccaagcccagcctgacagcccc
agcgctcagcttgccctcattgctgccagccagagcttcctgcagccaggtgggaagatg
gtggcagctgcaaaggcctcagtgccaacgattcaggaccaggcttcagccatgcagctg
agtcagtgtgccaagaacctgggcaccgcgctggctgaactccggacggctgcccagaag
gctcaggaagcatgtggacctttggagatggattctgcactgagtgtggtacagaatcta
gagaaagatctacaggaagtgaaggcagcagctcgagatggcaagcttaaacccttacct
ggggagacaatggagaagtgtacccaggacctgggcaacagcaccaaagccgtgagctca
gccatcgcccagctactgggagaggttgcccagggcaatgagaattatgcaggtattgca
gctcgggatgtggcaggtgggctgcggtcactggcccaggccgctaggggagtcgctgca
ctgacgtcagatcctgcagtgcaggccattgtacttgatacggccagtgatgtgctggac
aaggccagcagcctcattgaggaggcgaaaaaggcagctggccatccaggggaccctgag
agccagcagcggcttgcccaggtggctaaagcagtgacccaggctctgaaccgctgtgtc
agctgcctacctggccagcgcgatgtggataatgccctgagggcagttggagatgccagc
aagcgactcctgagtgactcgcttcctcctagcactgggacatttcaagaagctcagagc
cggttgaatgaagctgctgctgggctgaatcaggcagccacagaactggtgcaggcctct
cggggaacccctcaggacctggctcgagcctcaggccgatttggacaggacttcagcacc
ttcctggaagctggtgtggagatggcaggccaggctccgagccaggaggaccgagcccaa
gttgtgtccaacttgaagggcatctccatgtcttcaagcaaacttcttctggctgccaag
gccctgtccacggaccctgctgcccctaacctcaagagtcagctggctgcagctgccagg
gcagtaactgacagcatcaatcagctcatcactatgtgcacccagcaggcacccggccag
aaggagtgtgataacgccctgcgggaattggagacggtccgggaactcctggagaaccca
gtccagcccatcaatgacatgtcctactttggttgcctggacagtgtaatggagaactca
aaggtgctgggcgaggccatgactggcatctcccaaaatgccaagaacggaaacctgcca
gagtttggagatgccatttccacagcctcaaaggcactttgtggcttcaccgaggcagct
gcacaggctgcatatctggttggtgtctctgaccccaatagccaagctggacagcaaggg
ctagtggagcccacacagtttgcccgtgcaaaccaggcaattcagatggcctgccagagt
ttgggagagcctggctgtacccaggcccaggtgctctctgcagccaccattgtggctaaa
cacacctctgcactgtgtaacagctgtcgcctggcttctgcccgtaccaccaatcctact
gccaagcgccagtttgtacagtcagccaaggaggtggccaacagcacagctaatcttgtc
aagaccatcaaggcgctagatggggccttcacagaggagaaccgtgcccagtgccgagca
gcaacagcccctctgctggaggctgtggacaatctgagtgcctttgcgtccaaccctgag
ttctccagcattcctgcccagatcagccctgagggtcgggctgccatggagcccattgtg
atctctgccaagacaatgttagagagtgccgggggactcatccagacagcccgggccctc
gcagtcaatccccgggaccccccgagctggtcggtgctggccggccactcccgtactgtc
tcagactccatcaagaagctaattacaagcatgagggacaaggctccagggcagctggag
tgtgaaacggccattgcagctctgaacagttgtctacgggacctagaccaggcttccctc
gctgcagtcagccagcagcttgctccccgtgagggaatctctcaagaggccttgcacact
cagatgctcactgcagtccaagagatctcccatctcattgagccgctggccaatgctgcc
cgggctgaagcctcccagctgggacacaaggtgtcccagatggcgcagtactttgagccg
ctcaccctggctgcagtgggtgctgcctccaagaccctgagccacccgcagcagatggca
ctcctggaccagactaaaacattggcagagtctgccctgcagttgctatacactgccaag
gaggctggtggtaacccaaagcaagcagctcacacccaggaagccctggaggaggctgtg
cagatgatgaccgaggccgtagaggacctgacaacaaccctcaacgaggcagccagtgct
gctggggtcgtgggtggcatggtggactccatcacccaggccatcaaccagctagatgaa
ggaccaatgggtgaaccagaaggttccttcgtggattaccaaacaactatggtgcggaca
gccaaggccattgcagtgaccgttcaggagatggttaccaagtcaaacaccagcccagag
gagctgggccctcttgctaaccagctgaccagtgactatggccgtctggcctcggaggcc
aagcctgcagcggtggctgctgaaaatgaagagataggttcccatatcaaacaccgggta
caggagctgggccatggctgtgccgctctggtcaccaaggcaggcgccctgcagtgcagc
cccagtgatgcctacaccaagaaggagctcatagagtgtgcccggagagtctctgagaag
gtctcccacgtcctggctgcgctccaggctgggaatcgtggcacccaggcctgcatcaca
gcagccagcgctgtgtctggtatcattgctgacctcgacaccaccatcatgttcgccact
gctggcacgctcaatcgtgagggtactgaaactttcgctgaccaccgggagggcatcctg
aagactgcgaaggtgctggtggaggacaccaaggtcctggtgcaaaacgcagctgggagc
caggagaagttggcgcaggctgcccagtcctccgtggcgaccatcacccgcctcgctgat
gtggtcaagctgggtgcagccagcctgggagctgaggaccctgagacccaggtggtacta
atcaacgcagtgaaagatgtagccaaagccctgggagacctcatcagtgcaacgaaggct
gcagctggcaaagttggagatgaccctgctgtgtggcagctaaagaactctgccaaggtg
atggtgaccaatgtgacatcattgcttaagacagtaaaagccgtggaagatgaggccacc
aaaggcactcgggccctggaggcaaccacagaacacatacggcaggagctggcggttttc
tgttccccagagccacctgccaagacctctaccccagaagacttcatccgaatgaccaag
ggtatcaccatggcaaccgccaaggccgttgctgctggcaattcctgtcgccaggaagat
gtcattgccacagccaatctgagccgccgtgctattgcagatatgcttcgggcttgcaag
gaagcagcttaccacccagaagtggcccctgatgtgcggcttcgagccctgcactatggc
cgggagtgtgccaatggctacctggaactgctggaccatgtactgctgaccctgcagaag
ccaagcccagaactgaagcagcagttgacaggacattcaaagcgtgtggctggttccgtc
actgagctcatccaggctgctgaagccatgaagggaacagaatgggtagacccagaggac
cccacagtcattgctgagaatgagctcctgggagctgcagccgccattgaggctgcagcc
aaaaagctagagcagctgaagccccgggccaaacccaaggaggcagatgagtccttgaac
tttgaggagcagatactagaagctgccaagtccattgcagcagccaccagtgcactggta
aaggctgcgtcggctgcccagagagaactagtggcccaagggaaggtgggtgccattcca
gccaatgcactggacgatgggcagtggtcccagggcctcatttctgctgcccggatggtg
gctgcggccaccaacaatctgtgtgaggcagccaatgcagctgtacaaggccatgccagc
caggagaagctcatctcatcagccaagcaggtagctgcctccacagcccagctccttgtg
gcctgcaaggtcaaggctgaccaggactcggaggcaatgaaacgacttcaggctgctggc
aacgcagtgaagcgagcctcagataatctggtgaaagcagcacagaaggctgcagccttt
gaagagcaggagaatgagacagtggtggtgaaagagaagatggttggcggcattgcccag
atcatcgcagcacaggaagaaatgcttcggaaggaacgagagctggaagaggcgcggaag
aaactggcccagatccggcagcagcagtacaagtttctgccttcagagcttcgagatgag
cactaa

KEGG   Homo sapiens (human): 83660
Entry
83660             CDS       T01001                                 
Symbol
TLN2, ILWEQ
Name
(RefSeq) talin 2
  KO
K06271  talin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04510  Focal adhesion
hsa04611  Platelet activation
hsa05131  Shigellosis
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    83660 (TLN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    83660 (TLN2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    83660 (TLN2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    83660 (TLN2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    83660 (TLN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    83660 (TLN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83660 (TLN2)
  Exosomal proteins of other cancer cells
   83660 (TLN2)
SSDB
Motif
Pfam: VBS I_LWEQ Talin_middle FERM_f0 FERM_M FERM_N IRS ACBP GIT1_C
Other DBs
NCBI-GeneID: 83660
NCBI-ProteinID: NP_055874
OMIM: 607349
HGNC: 15447
Ensembl: ENSG00000171914
Pharos: Q9Y4G6(Tbio)
UniProt: Q9Y4G6
Structure
LinkDB
Position
15:62390550..62844631
AA seq 2542 aa
MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLEAGRTLDYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSR
IGITNYEEYSLIQETIEEKKEEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVDENETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEF
GGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMSEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEVLQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMV
GQMHRGHMPPLTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAAL
MDDEVGSGEDLLRAARTLAGAVSDLLKAVQPTSGEPRQTVLTAAGSIGQASGDLLRQIGE
NETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLV
ACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQVSAAASVVSQA
LHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGL
RVATNAAAQNAIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKA
VADHIPQLVQGVRGSQAQAEDLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAM
QLSQCAKNLATSLAELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAAVESQLKP
LPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTGVAARETAQALKTLAQAARGV
AASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQVAKAVSHSLNN
CVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLA
AKSLSVDPGAPNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLD
NPNEPVSDLSYFDCIESVMENSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTE
AAAQAAYLVGISDPNSQAGHQGLVDPIQFARANQAIQMACQNLVDPGSSPSQVLSAATIV
AKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTANLVKTIKALDGDFSEDNRNKC
RIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLESSSYLIRTAR
SLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYF
EPLILAAVGVASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEA
AQLMKEAVDDIMVTLNEAASEVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVK
YSKAIAVTAQEMMTKSVTNPEELGGLASQMTSDYGHLAFQGQMAAATAEPEEIGFQIRTR
VQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTEKVSLVLSALQAGNKGTQACI
TAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVEDTKLLVSGAAS
TPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKTSSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTAC
KQASFHPDVSDEVRTRALRFGTECTLGYLDLLEHVLVILQKPTPEFKQQLAAFSKRVAGA
VTELIQAAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAADDGQWSQGLISAARM
VAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK
KLAQIRQQQYKFLPTELREDEG
NT seq 7629 nt   +upstreamnt  +downstreamnt
atggtggccctgtccttaaagatttgtgtgcgccactgcaacgtggtgaagaccatgcag
tttgaaccatctacagctgtgtacgatgcgtgtcgagtcattcgggaacgggtgcctgag
gcacaaactgggcaagcttctgactatggactctttctttcggatgaagacccgaggaaa
gggatttggctggaagcgggcagaacactggattactacatgttgcggaatggggatatt
ttggaatataaaaagaaacagagacctcagaaaatccggatgctggatggatctgtgaag
acagtgatggtggatgattccaagactgtgggggagctcctggtcactatttgtagcaga
ataggaataacaaattatgaagaatactccttaatccaagaaactattgaagaaaagaaa
gaggaaggaacgggcacactcaaaaaagacaggacactgttacgagatgagaggaaaatg
gagaagttgaaggccaagctgcacacagatgatgacctaaattggctggatcacagccga
acattcagagaacaaggagtagatgaaaacgaaacgttgctgcttagacggaagttcttt
tactctgatcagaatgtagattcgagagaccccgtgcagctgaacttgctttatgttcag
gcacgggatgacatcctgaatggctctcaccctgtctccttcgagaaagcttgtgagttt
ggtggatttcaagcccagatacaatttggacctcatgtggaacataaacacaaacctgga
tttttagatctgaaggaattcctgcccaaagaatatatcaagcagagaggagctgaaaag
aggatctttcaggagcataagaactgcggagagatgagtgagatagaagccaaggtcaag
tacgtcaaactcgcacggtccctccgcacatatggcgtgtccttcttcctggtgaaggag
aagatgaaaggcaagaacaagctggtgcctcgcctgctggggatcaccaaagactcggtg
atgcgcgtggatgagaagaccaaggaagtgctgcaggagtggcccctcaccaccgtcaag
cgctgggcagcctcacccaagagcttcacactggattttggggagtatcaggaaagctac
tattcagtacaaaccaccgagggagagcagatatcccagctgattgcaggctacattgac
atcatcctgaaaaagaaacaaagtaaagatcgatttggactagaaggtgatgaggagtca
accatgttagaagagtccgtttccccaaaaaagtccaccatcttgcagcagcagttcaac
cggaccgggaaggcagagcacggctcagtggcgctgccggccgtgatgcgctcgggctcc
agcgggcctgagaccttcaacgttggcagcatgccctcgccacagcagcaggtcatggtt
gggcagatgcaccgaggccacatgccgccactgacctcagcccagcaggccctgatgggg
accatcaacacaagcatgcacgccgtccagcaggcccaggatgatctcagtgagctcgac
tcgctgccacctctcggccaggatatggcatctagggtatgggttcagaacaaagtcgac
gaatccaaacacgaaatccattctcaagttgatgctatcacggccggaacggcttcagtt
gttaacctcacagctggtgaccctgcagacactgactacacagctgtgggatgtgcgatc
accactatttcttccaacctgacggagatgtccaagggtgtgaagctattggccgccctc
atggatgatgaggtgggcagcggggaggacttgctcagagctgccaggaccctcgctggg
gcggtgtcagacttgctgaaagctgtgcagcctacttctggagagcctcgacagacagtt
ttgactgctgctggcagcatcggacaagccagtggggatcttctgagacagattggagag
aatgagactgatgagcgattccaggatgttttaatgagtttggccaaagctgttgccaat
gcagctgccatgttggtactaaaggcaaagaatgttgcccaagtggccgaagacactgtc
ctacagaacagggtaattgctgctgccacccagtgtgccctctccacctcccagcttgtg
gcatgtgccaaggttgtgagccccactattagctcccctgtgtgccaggagcagctgatt
gaagcagggaagctggtggaccgctcggtggagaactgtgtccgtgcctgccaggcggcc
actaccgatagtgagctcctgaagcaggtcagcgcagcggccagcgtggtcagccaggcc
ctccatgatctcctgcagcatgtgcggcagtttgccagccgaggcgagcccatcggccgc
tacgaccaggctactgacaccatcatgtgtgtcaccgagagcatcttcagctccatgggt
gacgctggtgaaatggtgcgccaggcgcgggttctggcccaagccacatcagacctcgtc
aatgccatgaggtcagatgcagaagccgaaatcgacatggagaattcaaagaagctcctg
gcagcagcaaaactcttagctgactccactgctcgcatggtggaagctgcaaagggggct
gcagccaacccagagaatgaggaccagcagcaaaggctgagagaagctgcagaaggcctc
cgggtagcaaccaacgcagctgcccagaatgctattaagaaaaaaattgtcaaccgactg
gaggttgcagccaagcaggccgcagcggcagccacacagaccatcgccgcctcccagaat
gcagctgtttccaacaagaaccctgcggcccagcagcagctggtccagagttgcaaggca
gtggctgatcacatccctcagctggtccagggagtgagggggagccaagctcaagctgaa
gacctgagtgcccagctggctctcatcatctccagccagaacttcctccagcctggaagc
aagatggtgtcctctgccaaagccgcagtgcccaccgtgagtgaccaggccgcagccatg
cagctgagccagtgtgccaagaacctggccaccagcttggcggagctgcgtaccgcctcg
cagaaggcccatgaagcttgtggtccgatggaaatcgattcagctctgaatacggtgcag
acgcttaagaatgaactgcaggatgccaagatggcagccgtggagagccagctgaagcca
cttccaggggaaacgctggaaaaatgtgctcaggacctgggaagcacatccaaggcggtg
ggctcctccatggcacagctgctgacctgtgctgctcaaggcaacgaacactacacaggg
gtggctgctagagagacggcccaagctctgaaaacactggcccaggccgcccgtggagtg
gctgcatcgacaaccgaccccgcggccgcccatgccatgttagattctgctcgagacgtg
atggagggctccgccatgctcattcaagaggccaagcaggccctgattgcacctggagat
gcagagcgtcaacaaagactggctcaggtggctaaagccgtctcacactccttgaataac
tgcgtaaattgcctccctgggcagaaggatgtggacgtggccttgaagagcatcggggag
tccagcaagaagctgcttgtggattcgctacctccaagcacgaagcctttccaggaagcc
cagagtgaactgaaccaggcagcagctgatctgaaccagtctgctggggaagtggtccat
gccacccggggccagagtggagagttggctgcagcctctggaaagttcagtgatgatttt
gatgaattcctcgatgctggcattgagatggctggccaagctcagacaaaagaagaccag
atccaagtgatagggaacctcaagaatatctcgatggcatccagcaagctgctgttagct
gccaagtctctctctgtagatccaggagctcccaatgcgaaaaatctcctggctgcagct
gcaagagctgtgacagagagcatcaatcaactcatcactctgtgtacccaacaagctccg
ggccagaaagagtgcgataatgccctgcgggagctcgagactgtgaaggggatgttggac
aatcctaatgaacctgttagtgacctctcttactttgactgcattgagagtgtgatggaa
aactccaaggttctgggtgaatcgatggcagggatttcacagaatgccaagaccggagac
ctccctgcctttggggaatgtgtggggattgcatccaaggctctctgtgggctgacagag
gctgcagcccaggctgcatacttggttggcatctctgatccaaacagccaggcaggccac
cagggcctggtggaccccatccagtttgccagggctaaccaggccatccagatggcatgc
cagaacttggtggaccctggcagcagcccatcacaggtcctgtcagccgccacaattgtt
gccaagcacacgtcagccttgtgcaatgcctgccgcatcgcctcatccaagacggccaac
ccagtagccaagaggcacttcgtccagtcagccaaggaagtcgccaacagcactgccaac
ctggtgaagaccatcaaggccctggatggggatttctctgaagacaaccgcaataagtgt
cgcatcgccaccgcacccttgattgaagctgtggagaacctgacagcgttcgcctcaaac
cctgagtttgtcagcattcctgcccagatcagctccgagggttcccaggcacaggaacca
atcctggtctcagccaagaccatgctggagagttcatcgtacctcattcgcactgcacgc
tctctggccatcaaccccaaagacccacccacctggtctgtactggctggacattcccat
acagtgtccgactccatcaagagtctcatcacttctatcagggacaaggcccctggacag
agggagtgtgattactccatcgatggcatcaaccggtgcatccgggacatcgagcaggcc
tcgctggccgccgtcagccagagcctggccacgagggacgacatctctgtggaggccctg
caggagcagctgacttcggtggtccaggaaatcggacaccttatcgatcccatcgccaca
gcggctcggggagaagcagctcagctgggacataaggtgacacaactggcaagctatttt
gagcccttgatcttagccgcagttggtgtggcctccaagattcttgatcatcagcagcag
atgacggtgctggaccagaccaagactctcgcagagtctgccttgcagatgttgtatgca
gccaaagaaggtggcggaaaccccaaggcacaacacacccatgacgccatcacagaggcc
gcccagttgatgaaggaagccgtggatgacatcatggtgacgctgaacgaagctgccagt
gaagtggggctggttgggggcatggtggacgccattgcagaagccatgagcaagctggat
gaaggcactcctccagaaccaaagggaacatttgtcgactatcagacgactgtggttaaa
tactccaaagccattgcggtgacagctcaggaaatgatgactaagtcggttactaacccg
gaggagttgggaggactggcttcacaaatgaccagtgactatgggcacctggctttccag
ggccagatggcagcagccacggcggaaccagaggagatcggattccagattcgcactcgt
gtgcaggacctgggccacggctgtatcttcctggtgcagaaggcaggggccctccaggtc
tgccccacagacagctacaccaagagggagctgatcgaatgcgcccgtgccgtcacggaa
aaggtctccttggtgctctcggctctccaggccgggaacaaaggaacccaggcatgcatt
acagccgccaccgctgtgtctgggatcattgccgacctggacaccaccattatgtttgca
acagcggggacgctgaatgcagagaacagtgagaccttcgcagaccacagggagaacatt
ctcaagacggccaaggccttggtagaagacacgaaactacttgtgtcaggagctgcgtcc
actcctgacaagctggcccaggcggcccagtcctcagcagccaccatcacccagctcgca
gaagtggtcaagctgggggcagccagcctgggctccgacgaccccgagacccaggtggtt
ttgatcaatgccatcaaagatgtggccaaggccctttctgatctcatcagtgctaccaag
ggagctgccagcaagccagtggacgacccttccatgtaccagctcaagggggctgccaag
gtgatggtgaccaatgtcacctcgctcctcaagactgtaaaggcagtggaggatgaggcc
acccggggcaccagggcgcttgaggccacaattgaatgcataaagcaggagcttacggtg
ttccagtcaaaagacgtacctgaaaagacatcatcacctgaagaatccataaggatgacg
aaaggcatcaccatggcaacagccaaagccgtggcagctgggaactcatgtagacaggag
gacgtgattgctactgccaacctgagccggaaagccgtgtcagatatgttgacggcttgc
aagcaagcatccttccaccccgatgtcagtgacgaggtgagaaccagagccttgcgtttc
gggacggagtgcacccttggctacttggacctcctggagcacgtcttggtgattcttcag
aaaccaaccccagaattcaagcagcagctggccgctttctccaagcgagtcgccggcgct
gtgacagagctcatccaggcggcggaagccatgaaaggaacagagtgggtggatccagaa
gacccaactgtcattgcagaaacagagttactgggggctgcagcatccatcgaagctgct
gctaagaagttagagcaactgaagccaagagcaaaaccaaaacaagcggatgagaccctg
gactttgaggaacagatcttggaagctgctaaatccattgctgctgccacaagcgccctg
gtcaaatcggcctcagcagcccagagggagctggtggcccaaggaaaggtgggctccatc
cctgccaatgctgcagacgacggacagtggtcacaggggctgatttctgctgcccggatg
gtggcggctgcgaccagcagtctctgtgaggcggccaatgcctccgttcagggacacgcc
agcgaggagaagctcatctcatctgccaagcaggtcgccgcttccacggctcagctgctg
gtggcctgcaaggtgaaggccgaccaggattcagaggccatgaggcggctacaggcggca
ggaaatgctgtgaaaagagcctcagacaatcttgtccgtgcagcccagaaggcagctttt
ggcaaagctgatgacgacgatgttgtagtgaaaaccaagtttgtggggggcattgctcag
atcatcgccgcccaggaagaaatgctaaagaaagagcgagaactggaagaagcaaggaaa
aaactggcccaaatccgccagcagcagtataagtttttacccaccgagctgagggaagat
gagggctaa

KEGG   Homo sapiens (human): 7414
Entry
7414              CDS       T01001                                 
Symbol
VCL, CMD1W, CMH15, HEL114, MV, MVCL
Name
(RefSeq) vinculin
  KO
K05700  vinculin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05146  Amoebiasis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01082  Shigella IpaA to ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7414 (VCL)
   04520 Adherens junction
    7414 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7414 (VCL)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7414 (VCL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7414 (VCL)
   05100 Bacterial invasion of epithelial cells
    7414 (VCL)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7414 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7414 (VCL)
   04147 Exosome [BR:hsa04147]
    7414 (VCL)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     7414 (VCL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7414 (VCL)
SSDB
Motif
Pfam: Vinculin VMAP-M0 CARD
Other DBs
NCBI-GeneID: 7414
NCBI-ProteinID: NP_054706
OMIM: 193065
HGNC: 12665
Ensembl: ENSG00000035403
Pharos: P18206(Tbio)
UniProt: P18206 V9HWK2 B3KXA2
Structure
LinkDB
Position
10:73998116..74121363
AA seq 1134 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ
PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK
DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgccagtgtttcatacgcgcacgatcgagagcatcctggagccggtggcacagcagatc
tcccacctggtgataatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtggccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcaaaccactgaggatcagattttgaagagagatatgccaccagcatttattaag
gttgagaatgcttgcaccaagcttgtccaggcagctcagatgcttcagtcagacccttac
tcagtgcctgctcgagattatctaattgatgggtcaaggggcatcctctctggaacatca
gacctgctccttaccttcgatgaggctgaggtccgtaaaattattagagtttgcaaagga
attttggaatatcttacagtggcagaggtggtggagactatggaagatttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaagatgattgacgagagacagcag
gagctcactcaccaggagcaccgagtgatgttggtgaactcgatgaacaccgtgaaagag
ttgctgccagttctcatttcagctatgaagatttttgtaacaactaaaaactcaaaaaac
caaggcatagaggaagctttaaaaaatcgcaattttactgtagaaaaaatgagtgctgaa
attaatgagataattcgtgtgttacaactcacctcttgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcattggcctccatagactccaaactgaaccaggcc
aaaggttggctccgtgaccctagtgcctccccaggggatgctggtgagcaggccatcaga
cagatcttagatgaagctggaaaagttggtgaactctgtgcaggcaaagaacgcagggag
attctgggaacttgcaaaatgctagggcagatgactgatcaagtggctgacctccgtgcc
agaggacaaggatcctcaccggtggccatgcagaaagctcagcaggtatctcagggtctg
gatgtgctcacagcaaaagtggaaaatgcagctcgcaagctggaagccatgaccaactca
aagcagagcattgcaaagaagatcgatgctgctcagaactggcttgcagatccaaatggt
ggaccggaaggagaagagcagattcgaggtgctttggctgaagctcggaaaatagcagaa
ttatgtgatgatcctaaagaaagagatgacattctacgttcccttggggaaatatctgct
ctgacttctaaattagcagatctacgaagacaggggaaaggagattctccagaggctcga
gccttggccaaacaggtggccacggccctgcagaacctgcagaccaaaaccaaccgggct
gtggccaacagcagaccggccaaagcagctgtacaccttgagggcaagattgagcaagca
cagcggtggattgataatcccacagtggatgaccgtggagtcggtcaggctgccatccgg
gggcttgtggccgaagggcatcgtctggctaatgttatgatggggccttatcggcaagat
cttctcgccaagtgtgaccgagtggaccagctgacagcccagctggctgacctggctgcc
agaggggaaggggagagtcctcaggcacgagcacttgcatctcagctccaagactcctta
aaggatctaaaagctcggatgcaggaggccatgactcaggaagtgtcagatgttttcagc
gataccacaactcccatcaagctgttggcagtggcagccacggcgcctcctgatgcgcct
aacagggaagaggtatttgatgagagggcagctaactttgaaaaccattcaggaaagctt
ggtgctacggccgagaaggcggctgcggttggtactgctaataaatcaacagtggaaggc
attcaggcctcagtgaagacggcccgagaactcacaccccaggtggtctcggctgctcgt
atcttacttaggaaccctggaaatcaagctgcttatgaacattttgagaccatgaagaac
cagtggatcgataatgttgaaaaaatgacagggctggtggacgaagccattgataccaaa
tctctgttggatgcttcagaagaagcaattaaaaaagacctggacaagtgcaaggtagct
atggccaacattcagcctcagatgctggttgctggggcaaccagtattgctcgtcgggcc
aaccggatcctgctggtggctaagagggaggtggagaattccgaggatcccaagttccgt
gaggctgtgaaagctgcctctgatgaattgagcaaaaccatctccccgatggtgatggat
gcaaaagctgtggctggaaacatttccgaccctggactgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgccgcctccaccagaccttgaacaactccgactaacagatgagcttgctcct
cccaaaccacctctgcctgaaggtgaggtccctccacctaggcctccaccaccagaggaa
aaggatgaagagttccctgagcagaaggccggggaggtgattaaccagccaatgatgatg
gctgccagacagctccatgatgaagctcgcaaatggtccagcaagccgggcatcccagcc
gctgaggtgggtataggtgttgtagctgaggcagatgcggccgatgctgctggcttccct
gtcccccctgacatggaagacgattacgaacctgagctgctgttaatgccatccaatcag
ccggtcaaccagcccattctggccgcggctcagtccttgcatcgggaagctaccaagtgg
tctagtaagggcaatgacatcattgcagcagccaagcgcatggctctgctgatggctgag
atgtctcggctggtaagagggggcagtggtaccaagcgggcactcattcagtgtgccaag
gacatcgccaaggcctcagatgaggtgactcggttggccaaggaggttgccaagcagtgc
acagataaacggattagaaccaacctcttacaggtatgtgagcgaatcccaaccataagc
acccagctcaaaatcctgtccacagtgaaggccaccatgctgggccggaccaacatcagt
gatgaggagtctgagcaggccacagagatgctggttcacaatgcccagaacctcatgcag
tctgtgaaggagactgtgcgggaagctgaagctgcttcaatcaaaattcgaacagatgct
ggatttacactgcgctgggttagaaagactccctggtaccagtag

DBGET integrated database retrieval system