KEGG   Homo sapiens (human): 2890Help
Entry
2890              CDS       T01001                                 

Gene name
GRIA1, GLUH1, GLUR1, GLURA, GluA1, HBGR1
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 1
  KO
K05197  glutamate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Troriluzole (DG03011): D11414
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2890 (GRIA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2890 (GRIA1)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2890 (GRIA1)
   04728 Dopaminergic synapse
    2890 (GRIA1)
   04720 Long-term potentiation
    2890 (GRIA1)
   04730 Long-term depression
    2890 (GRIA1)
   04723 Retrograde endocannabinoid signaling
    2890 (GRIA1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2890 (GRIA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    2890 (GRIA1)
  09165 Substance dependence
   05031 Amphetamine addiction
    2890 (GRIA1)
   05033 Nicotine addiction
    2890 (GRIA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2890 (GRIA1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2890 (GRIA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF659 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2890
NCBI-ProteinID: NP_000818
OMIM: 138248
HGNC: 4571
Ensembl: ENSG00000155511
Vega: OTTHUMG00000130148
Pharos: P42261(Tclin)
UniProt: P42261 Q59GL5
LinkDB All DBs
Position
5q33.2
AA seq 906 aa AA seqDB search
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atgcagcacatttttgccttcttctgcaccggtttcctaggcgcggtagtaggtgccaat
ttccccaacaatatccagatcgggggattatttccaaaccagcagtcacaggaacatgct
gcttttagatttgctttgtcgcaactcacagagcccccgaagctgctcccccagattgat
attgtgaacatcagcgacagctttgagatgacctatagattctgttcccagttctccaaa
ggagtctatgccatctttgggttttatgaacgtaggactgtcaacatgctgacctccttt
tgtggggccctccacgtctgcttcattacgccgagctttcccgttgatacatccaatcag
tttgtccttcagctgcgccctgaactgcaggatgccctcatcagcatcattgaccattac
aagtggcagaaatttgtctacatttatgatgccgaccggggcttatccgtcctgcagaaa
gtcctggatacagctgctgagaagaactggcaggtgacagcagtcaacattttgacaacc
acagaggagggataccggatgctctttcaggacctggagaagaaaaaggagcggctggtg
gtggtggactgtgaatcagaacgcctcaatgctatcttgggccagattataaagctagag
aagaatggcatcggctaccactacattcttgcaaatctgggcttcatggacattgactta
aacaaattcaaggagagtggcgccaatgtgacaggtttccagctggtgaactacacagac
actattccggccaagatcatgcagcagtggaagaatagtgatgctcgagaccacacacgg
gtggactggaagagacccaagtacacctctgcgctcacctacgatggggtgaaggtgatg
gctgaggctttccagagcctgcggaggcagagaattgatatatctcgccgggggaatgct
ggggattgtctggctaacccagctgttccctggggccaagggatcgacatccagagagct
ctgcagcaggtgcgatttgaaggtttaacaggaaacgtgcagtttaatgagaaaggacgc
cggaccaactacacgctccacgtgattgaaatgaaacatgacggcatccgaaagattggt
tactggaatgaagatgataagtttgtccctgcagccaccgatgcccaagctgggggcgat
aattcaagtgttcagaacagaacatacatcgtcacaacaatcctagaagatccttatgtg
atgctcaagaagaacgccaatcagtttgagggcaatgaccgttacgagggctactgtgta
gagctggcggcagagattgccaagcacgtgggctactcctaccgtctggagattgtcagt
gatggaaaatacggagcccgagaccctgacacgaaggcctggaatggcatggtgggagag
ctggtctatggaagagcagatgtggctgtggctcccttaactatcactttggtccgggaa
gaagttatagatttctccaaaccatttatgagtttggggatctccatcatgattaaaaaa
ccacagaaatccaagccgggtgtcttctccttccttgatcctttggcttatgagatttgg
atgtgcattgtttttgcctacattggagtgagtgttgtcctcttcctggtcagccgcttc
agtccctatgaatggcacagtgaagagtttgaggaaggacgggaccagacaaccagtgac
cagtccaatgagtttgggatattcaacagtttgtggttctccctgggagccttcatgcag
caaggatgtgacatttctcccaggtccctgtctggtcgcatcgttggtggcgtctggtgg
ttcttcaccttaatcatcatctcctcatatacagccaatctggccgccttcctgaccgtg
gagaggatggtgtctcccattgagagtgcagaggacctagcgaagcagacagaaattgcc
tacgggacgctggaagcaggatctactaaggagttcttcaggaggtctaaaattgctgtg
tttgagaagatgtggacatacatgaagtcagcagagccatcagtttttgtgcggaccaca
gaggaggggatgattcgagtgaggaaatccaaaggcaaatatgcctacctcctggagtcc
accatgaatgagtacattgagcagcggaaaccctgtgacaccatgaaggtgggaggtaac
ttggattccaaaggctatggcattgcaacacccaaggggtctgccctgagaaatccagta
aacctggcagtgttaaaactgaacgagcaggggcttttggacaaattgaaaaacaaatgg
tggtacgacaagggcgagtgcggcagcgggggaggtgattccaaggacaagacaagcgct
ctgagcctcagcaatgtggcaggcgtgttctacatcctgatcggaggacttggactagcc
atgctggttgccttaatcgagttctgctacaaatcccgtagtgaatccaagcggatgaag
ggtttttgtttgatcccacagcaatccatcaacgaagccatacggacatcgaccctcccc
cgcaacagcggggcaggagccagcagcggcggcagtggagagaatggtcgggtggtcagc
catgacttccccaagtccatgcaatcgattccttgcatgagccacagttcagggatgccc
ttgggagccacgggattgtaa

KEGG   Homo sapiens (human): 2891Help
Entry
2891              CDS       T01001                                 

Gene name
GRIA2, GLUR2, GLURB, GluA2, GluR-K2, HBGR2
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 2
  KO
K05198  glutamate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05014  Amyotrophic lateral sclerosis (ALS)
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Troriluzole (DG03011): D11414
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2891 (GRIA2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2891 (GRIA2)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2891 (GRIA2)
   04728 Dopaminergic synapse
    2891 (GRIA2)
   04720 Long-term potentiation
    2891 (GRIA2)
   04730 Long-term depression
    2891 (GRIA2)
   04723 Retrograde endocannabinoid signaling
    2891 (GRIA2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2891 (GRIA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    2891 (GRIA2)
  09165 Substance dependence
   05030 Cocaine addiction
    2891 (GRIA2)
   05031 Amphetamine addiction
    2891 (GRIA2)
   05033 Nicotine addiction
    2891 (GRIA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2891 (GRIA2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2891 (GRIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2891
NCBI-ProteinID: NP_000817
OMIM: 138247
HGNC: 4572
Ensembl: ENSG00000120251
Vega: OTTHUMG00000133836
Pharos: P42262(Tclin)
UniProt: P42262
LinkDB All DBs
Structure
PDB: 

Position
4q32.1
AA seq 883 aa AA seqDB search
MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTP
HIDNLEVANSFAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDG
THPFVIQMRPDLKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINV
GNINNDKKDEMYRSLFQDLELKKERRVILDCERDKVNDIVDQVITIGKHVKGYHYIIANL
GFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTLEEKEYPGAHTTTIKYTSALT
YDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNI
KFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKI
WNGMVGELVYGKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLD
PLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWF
SLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL
SKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEPSVFVRTTAEGVARVRKSKGK
YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRTPVNLAVLKLSEQGVL
DKLKNKWWYDKGECGAKDSGSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagattatgcatatttctgtcctcctttctcctgttttatggggactgattttt
ggtgtctcttctaacagcatacagataggggggctatttcctaggggcgccgatcaagaa
tacagtgcatttcgagtagggatggttcagttttccacttcggagttcagactgacaccc
cacatcgacaatttggaggtggcaaacagcttcgcagtcactaatgctttctgctcccag
ttttcgagaggagtctatgctatttttggattttatgacaagaagtctgtaaataccatc
acatcattttgcggaacactccacgtctccttcatcactcccagcttcccaacagatggc
acacatccatttgtcattcagatgagacccgacctcaaaggagctctccttagcttgatt
gaatactatcaatgggacaagtttgcatacctctatgacagtgacagaggcttatcaaca
ctgcaagctgtgctggattctgctgctgaaaagaaatggcaagtgactgctatcaatgtg
ggaaacattaacaatgacaagaaagatgagatgtaccgatcactttttcaagatctggag
ttaaaaaaggaacggcgtgtaattctggactgtgaaagggataaagtaaacgacattgta
gaccaggttattaccattggaaaacatgttaaagggtaccactacatcattgcaaatctg
ggatttactgatggagacctattaaaaatccagtttggaggtgcaaatgtctctggattt
cagatagtggactatgatgattcgttggtatctaaatttatagaaagatggtcaacactg
gaagaaaaagaataccctggagctcacacaacaacaattaagtatacttctgctctgacc
tatgatgccgttcaagtgatgactgaagccttccgcaacctaaggaagcaaagaattgaa
atctcccgaagggggaatgcaggagactgtctggcaaacccagcagtgccctggggacaa
ggtgtagaaatagaaagggccctcaaacaggttcaggttgaaggtctctcaggaaatata
aagtttgaccagaatggaaaaagaataaactatacaattaacatcatggagctcaaaact
aatgggccccggaagattggctactggagtgaagtggacaaaatggttgttacccttact
gagctcccttctggaaatgacacctctgggcttgagaataagactgttgttgtcaccaca
attttggaatctccgtatgttatgatgaagaaaaatcatgaaatgcttgaaggcaatgag
cgctatgagggctactgtgttgacctggctgcagaaatcgccaaacattgtgggttcaag
tacaagttgacaattgttggtgatggcaagtatggggccagggatgcagacacgaaaatt
tggaatgggatggttggagaacttgtatatgggaaagctgatattgcaattgctccatta
actattacccttgtgagagaagaggtgattgacttctcaaagcccttcatgagcctcggg
atatctatcatgatcaagaagcctcagaagtccaaaccaggagtgttttcctttcttgat
cctttagcctatgagatctggatgtgcattgtttttgcctacattggggtcagtgtagtt
ttattcctggtcagcagatttagcccctacgagtggcacactgaggagtttgaagatgga
agagaaacacaaagtagtgaatcaactaatgaatttgggatttttaatagtctctggttt
tccttgggtgcctttatgcggcaaggatgcgatatttcgccaagatccctctctgggcgc
attgttggaggtgtgtggtggttctttaccctgatcataatctcctcctacacggctaac
ttagctgccttcctgactgtagagaggatggtgtctcccatcgaaagtgctgaggatctt
tctaagcaaacagaaattgcttatggaacattagactctggctccactaaagagtttttc
aggagatctaaaattgcagtgtttgataaaatgtggacctacatgcggagtgcggagccc
tctgtgtttgtgaggactacggccgaaggggtggctagagtgcggaagtccaaagggaaa
tatgcctacttgttggagtccacgatgaacgagtacattgagcaaaggaagccttgcgac
accatgaaagttggtggaaacctggattccaaaggctatggcatcgcaacacctaaagga
tcctcattaagaaccccagtaaatcttgcagtattgaaactcagtgagcaaggcgtctta
gacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggagccaaggactctgga
agtaaggaaaagaccagtgccctcagtctgagcaacgttgctggagtattctacatcctt
gtcgggggccttggtttggcaatgctggtggctttgattgagttctgttacaagtcaagg
gccgaggcgaaacgaatgaaggtggcaaagaatgcacagaatattaacccatcttcctcg
cagaattcacagaattttgcaacttataaggaaggttacaacgtatatggcatcgaaagt
gttaaaatttag

KEGG   Homo sapiens (human): 2892Help
Entry
2892              CDS       T01001                                 

Gene name
GRIA3, GLUR-C, GLUR-K3, GLUR3, GLURC, GluA3, MRX94
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 3
  KO
K05199  glutamate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00120  MLL-ENL fusion to transcriptional activation
Disease
H00658  Syndromic X-linked mental retardation
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Troriluzole (DG03011): D11414
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2892 (GRIA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2892 (GRIA3)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2892 (GRIA3)
   04728 Dopaminergic synapse
    2892 (GRIA3)
   04730 Long-term depression
    2892 (GRIA3)
   04723 Retrograde endocannabinoid signaling
    2892 (GRIA3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2892 (GRIA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2892 (GRIA3)
  09165 Substance dependence
   05031 Amphetamine addiction
    2892 (GRIA3)
   05033 Nicotine addiction
    2892 (GRIA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2892 (GRIA3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2892 (GRIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 DUF2061 NusG_add
Motif
Other DBs
NCBI-GeneID: 2892
NCBI-ProteinID: NP_000819
OMIM: 305915
HGNC: 4573
Ensembl: ENSG00000125675
Vega: OTTHUMG00000022685
Pharos: P42263(Tclin)
UniProt: P42263 Q17R51
LinkDB All DBs
Position
Xq25
AA seq 894 aa AA seqDB search
MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALGNAVNL
AVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
NT seq 2685 nt NT seq  +upstreamnt  +downstreamnt
atggccaggcagaagaaaatggggcaaagcgtgctccgggcggtcttctttttagtcctg
gggcttttgggtcattctcacggaggattccccaacaccatcagcataggtggacttttc
atgagaaacacagtgcaggagcacagcgctttccgctttgccgtgcagttatacaacacc
aaccagaacaccaccgagaagcccttccatttgaattaccacgtagatcacttggattcc
tccaatagtttttccgtgacaaatgctttctgctcccagttctcgagaggggtgtatgcc
atctttggattctatgaccagatgtcaatgaacaccctgacctccttctgtggggccctg
cacacatcctttgttacgcctagcttccccactgacgcagatgtgcagtttgtcatccag
atgcgcccagccttgaagggcgctattctgagtcttctgggtcattacaagtgggagaag
tttgtgtacctctatgacacagaacgaggattttccatcctccaagcgattatggaagca
gcagtgcaaaacaactggcaagtaacagcaaggtctgtgggaaacataaaggacgtccaa
gaattcaggcgcatcattgaagaaatggacaggaggcaggaaaagcgatacttgattgac
tgcgaagtcgaaaggattaacacaattttggaacaggttgtgatcctagggaaacactca
agaggttatcactacatgctcgctaacctgggttttactgatattttactggaaagagtc
atgcatgggggagccaacattacaggtttccagattgtcaacaatgaaaaccctatggtt
cagcagttcatacagcgctgggtgaggctggatgaaagggaattccctgaagccaagaat
gcaccactaaagtatacatctgcattgacacacgacgcaatactggtcatagcagaagct
ttccgctacctgaggaggcagcgagtagatgtgtcccggagaggaagtgctggagactgc
ttagcaaatcctgctgtgccctggagtcaaggaattgatattgagagagctctgaaaatg
gtgcaagtacaaggaatgactggaaatattcaatttgacacttatggacgtaggacaaat
tataccatcgatgtgtatgaaatgaaagtcagtggctctcgaaaagctggctactggaat
gagtatgaaaggtttgtgcctttctcagatcagcaaatcagcaatgacagtgcatcctca
gagaatcggaccatagtagtgactaccattctggaatcaccatatgtaatgtacaagaag
aaccatgagcaactggaaggaaatgaacgatatgaaggctattgtgtagacctagcctat
gaaatagccaaacatgtaaggatcaaatacaaattgtccatcgttggtgacgggaaatat
ggtgcaagggatccagagactaaaatatggaacggcatggttggggaacttgtctatggg
agagctgatatagctgttgctccactcactataacattggtccgtgaagaagtcatagat
ttttcaaagccattcatgagcctgggcatctccatcatgataaagaagcctcagaaatca
aaaccaggcgtattctcatttctggatcccctggcttatgaaatctggatgtgcattgtc
tttgcttacattggagtcagcgtagttcttttcctagtcagcaggttcagtccttatgaa
tggcacttggaagacaacaatgaagaacctcgtgacccacaaagtcctcctgatcctcca
aatgaatttggaatatttaacagtctttggttttccttgggtgcctttatgcagcaagga
tgtgatatttctccaagatcactctccgggcgcattgttggaggggtttggtggttcttc
accctgatcataatttcttcctatactgccaatctcgctgctttcctgactgtggagagg
atggtttctcccatagagagtgctgaagacttagctaaacagactgaaattgcatatggg
accctggactccggttcaacaaaagaatttttcagaagatccaaaattgctgtgtacgag
aaaatgtggtcttacatgaaatcagcggagccatctgtgtttaccaaaacaacagcagac
ggagtggcccgagtgcgaaagtccaagggaaagttcgccttcctgctggagtcaaccatg
aatgagtacattgagcagagaaaaccatgtgatacgatgaaagttggtggaaatctggat
tccaaaggctatggtgtggcaacccctaaaggctcagcattaggaaatgctgttaacctg
gcagtattaaaactgaatgagcaaggcctcttggacaaattgaaaaacaaatggtggtac
gacaaaggagagtgcggcagcgggggcggtgactccaaggacaagaccagcgctctgagc
ctgagcaatgtggcaggcgttttctatatacttgtcggaggtctggggctggccatgatg
gtggctttgatagaattctgttacaaatcacgggcagagtccaaacgcatgaaactcaca
aagaacacccaaaactttaagcctgctcctgccaccaacactcagaattatgctacatac
agagaaggctacaacgtgtatggaacagagagtgttaagatctag

KEGG   Homo sapiens (human): 2893Help
Entry
2893              CDS       T01001                                 

Gene name
GRIA4, GLUR4, GLUR4C, GLURD, GluA4, NEDSGA
Definition
(RefSeq) glutamate ionotropic receptor AMPA type subunit 4
  KO
K05200  glutamate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04728  Dopaminergic synapse
hsa05031  Amphetamine addiction
hsa05033  Nicotine addiction
Drug target
Dasolampanel: D10107
Dasolampanel etibutil: D10108
Dasolampanel etibutil tosylate: D10109
Farampator: D04131
Mibampator: D09931
Perampanel (DG01901): D08964 D10780
Riluzole: D00775
Talampanel: D02696
Tezampanel: D06656
Topiramate: D00537
Troriluzole (DG03011): D11414
Zonampanel: D09035
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2893 (GRIA4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2893 (GRIA4)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    2893 (GRIA4)
   04728 Dopaminergic synapse
    2893 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    2893 (GRIA4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2893 (GRIA4)
 09160 Human Diseases
  09165 Substance dependence
   05031 Amphetamine addiction
    2893 (GRIA4)
   05033 Nicotine addiction
    2893 (GRIA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2893 (GRIA4)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   2893 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 2893
NCBI-ProteinID: NP_000820
OMIM: 138246
HGNC: 4574
Ensembl: ENSG00000152578
Vega: OTTHUMG00000166236
Pharos: P48058(Tclin)
UniProt: P48058 Q1WWK6
LinkDB All DBs
Position
11q22.3
AA seq 902 aa AA seqDB search
MRIISRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVIKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRSLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGTPVNLAVLKLSEAGV
LDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTAIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttccagacagattgtcttgttattttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcaaataggtggtctcttcatccgaaacacagatcaggaa
tacactgcttttcgattagcaatttttcttcataacaccagccccaatgcgtcggaagct
ccttttaatttggtacctcatgtggacaacattgagacagccaacagttttgctgtaaca
aacgccttctgttcccagtattctagaggagtatttgccatttttggactctatgataag
aggtcggtacataccttgacctcattctgcagcgccttacatatctccctcatcacacca
agtttccctactgagggggagagccagtttgtgctgcaactaagaccttcgttacgagga
gcactcttgagtttgctggatcactacgaatggaactgttttgtcttcctgtatgacaca
gacaggggatactcgatactccaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgacagaagacaagagaagaagtttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtaagtgttggaaagcatgttaaaggctaccattatatcattgca
aacttgggattcaaggatatttctcttgagaggtttatacatggtggagccaatgttact
ggattccagttggtggattttaatacacctatggtaatcaaactaatggatcgctggaag
aaactagatcagagagagtatccaggatctgagactcctccaaagtacacctctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaagtcttaggaggcagaaaatt
gatatctcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaagggctgacagggaat
gttcagtttgaccactatggacgtagagtcaattacacaatggatgtgtttgagctgaaa
agcacaggacctagaaaggttggttactggaatgatatggataagttagtcttgattcaa
gatgtaccaactcttggcaatgacacagctgctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcatgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcaagggatgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctattgcccct
ctgacaatcactttggtacgagaggaggtcattgacttttctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagtagatttagtccatatgagtggcacacagaagagccagaggac
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgcttttatgcagcaaggatgtgacatttcacccagatccctctcaggt
cgaattgttggaggtgtttggtggttctttacactcatcattatatcatcttatactgct
aacctcgctgctttcctgacggttgagcgaatggtctctcccatagaaagtgcagaagac
ctggccaaacaaacagaaattgcctatggaacactggattcaggatcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtatgaaaagatgtggacctacatgcgatcagcagag
ccatcagtattcactaggactacagctgagggagtagctcgtgtccgcaaatccaagggc
aaatttgcctttctcctggagtccactatgaatgaatacattgagcagcgaaagccatgt
gacacgatgaaagtgggaggaaatctggattccaaaggctatggagtagcaacgcccaag
ggttcctcattaggaactcctgtaaaccttgccgttttgaaactcagtgaggcaggcgtc
ttagacaagctgaaaaacaaatggtggtacgataaaggtgaatgtggacccaaggactct
ggaagcaaggacaagacgagtgccttgagcctgagcaatgtagcaggcgtcttctacatt
ctggttggcggcttgggcttggcaatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagtgtgggagagaatggccgcgtcttgacgcctgactgcccaaag
gctgtacacactggaactgcaatcagacaaagttcaggattggctgtcattgcatcggac
ctaccataa

DBGET integrated database retrieval system