KEGG   Homo sapiens (human): 367
Entry
367               CDS       T01001                                 

Gene name
AR, AIS, AR8, DHTR, HUMARA, HYSP1, KD, NR3C4, SBMA, SMAX1, TFM
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
Network
nt06227  Nuclear receptor signaling
nt06272  Prostate cancer
  Element
N00083  Androgen receptor signaling pathway
N00084  Amplified AR to androgen receptor signaling pathway
N00085  Mutation-activated AR to androgen receptor signaling pathway
Disease
H00024  Prostate cancer
H00062  Spinal and bulbar muscular atrophy (SBMA)
H00455  Spinal muscular atrophy
H02175  Hypospadias
H02177  Androgen insensitivity syndrome
Drug target
Androstanolone: D07456
Apalutamide: D11040<JP/US>
Benorterone: D03079
Bicalutamide: D00961<JP/US>
Bolasterone: D03144
Boldenone (DG01275): D03145 D07536
Calusterone: D03338
Chlormadinone (DG00469): D01299<JP> D07670
Cioteronel: D03515
Clascoterone: D11451
Clometherone: D03551
Cyproterone (DG00475): D01368 D07766
Danazol: D00289<JP/US>
Darolutamide: D11045<JP/US>
Delmadinone (DG02935): D03675 D07783
Dromostanolone propionate: D01534
Enobosarm: D10221
Enzalutamide: D10218<JP/US>
Fluoxymesterone: D00327<US>
Flutamide: D00586<JP/US>
Mestanolone: D01533
Mesterolone: D04947
Metandienone: D00389
Metenolone (DG00140): D01301 D01375<JP> D08193
Methandriol (DG01276): D08196 D08197
Methyltestosterone: D00408<US>
Mibolerone: D05025
Nandrolone (DG00142): D00955 D00956 D01476 D01737 D05116 D08250 D08251
Nilutamide: D00965<US>
Nisterime acetate: D05174
Norethandrolone: D07127
Osaterone acetate: D11105
Oxabolone cipionate: D01149
Oxandrolone: D00462<US>
Oxendolone: D01329
Oxymetholone: D00490<US>
Prasterone (DG00141): D01616<JP> D08409<US>
Quinbolone: D05674
Ralaniten (DG02945): D11184 D11185
Silandrone: D05837
Stanozolol: D00444
Testosterone (DG00460): D00075<US> D00957<US> D00958<JP/US> D00959 D06085 D06086 D06087<US> D08573 D08574
Topterone: D06191
Trenbolone (DG01631): D06211 D08627
Zanoterone: D06357
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    367 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    367 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    367 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    367 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    367 (AR)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen-like
    367 (AR)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   367 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4 U3_snoRNA_assoc Presenilin
Other DBs
NCBI-GeneID: 367
NCBI-ProteinID: NP_000035
OMIM: 313700
HGNC: 644
Ensembl: ENSG00000169083
Vega: OTTHUMG00000021740
Pharos: P10275(Tclin)
UniProt: P10275 Q9NUA2
LinkDB
Structure
PDB: 

Position
Xq12
AA seq 920 aa
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggaagtgcagttagggctgggaagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgctgctgctgcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaa
gagactagccccaggcagcagcagcagcagcagggtgaggatggttctccccaagcccat
cgtagaggccccacaggctacctggtcctggatgaggaacagcaaccttcacagccgcag
tcggccctggagtgccaccccgagagaggttgcgtcccagagcctggagccgccgtggcc
gccagcaaggggctgccgcagcagctgccagcacctccggacgaggatgactcagctgcc
ccatccacgttgtccctgctgggccccactttccccggcttaagcagctgctccgctgac
cttaaagacatcctgagcgaggccagcaccatgcaactccttcagcaacagcagcaggaa
gcagtatccgaaggcagcagcagcgggagagcgagggaggcctcgggggctcccacttcc
tccaaggacaattacttagggggcacttcgaccatttctgacaacgccaaggagttgtgt
aaggcagtgtcggtgtccatgggcctgggtgtggaggcgttggagcatctgagtccaggg
gaacagcttcggggggattgcatgtacgccccacttttgggagttccacccgctgtgcgt
cccactccttgtgccccattggccgaatgcaaaggttctctgctagacgacagcgcaggc
aagagcactgaagatactgctgagtattcccctttcaagggaggttacaccaaagggcta
gaaggcgagagcctaggctgctctggcagcgctgcagcagggagctccgggacacttgaa
ctgccgtctaccctgtctctctacaagtccggagcactggacgaggcagctgcgtaccag
agtcgcgactactacaactttccactggctctggccggaccgccgccccctccgccgcct
ccccatccccacgctcgcatcaagctggagaacccgctggactacggcagcgcctgggcg
gctgcggcggcgcagtgccgctatggggacctggcgagcctgcatggcgcgggtgcagcg
ggacccggttctgggtcaccctcagccgccgcttcctcatcctggcacactctcttcaca
gccgaagaaggccagttgtatggaccgtgtggtggtggtgggggtggtggcggcggcggc
ggcggcggcggcggcggcggcggcggcggcggcggcggcgaggcgggagctgtagccccc
tacggctacactcggccccctcaggggctggcgggccaggaaagcgacttcaccgcacct
gatgtgtggtaccctggcggcatggtgagcagagtgccctatcccagtcccacttgtgtc
aaaagcgaaatgggcccctggatggatagctactccggaccttacggggacatgcgtttg
gagactgccagggaccatgttttgcccattgactattactttccaccccagaagacctgc
ctgatctgtggagatgaagcttctgggtgtcactatggagctctcacatgtggaagctgc
aaggtcttcttcaaaagagccgctgaagggaaacagaagtacctgtgcgccagcagaaat
gattgcactattgataaattccgaaggaaaaattgtccatcttgtcgtcttcggaaatgt
tatgaagcagggatgactctgggagcccggaagctgaagaaacttggtaatctgaaacta
caggaggaaggagaggcttccagcaccaccagccccactgaggagacaacccagaagctg
acagtgtcacacattgaaggctatgaatgtcagcccatctttctgaatgtcctggaagcc
attgagccaggtgtagtgtgtgctggacacgacaacaaccagcccgactcctttgcagcc
ttgctctctagcctcaatgaactgggagagagacagcttgtacacgtggtcaagtgggcc
aaggccttgcctggcttccgcaacttacacgtggacgaccagatggctgtcattcagtac
tcctggatggggctcatggtgtttgccatgggctggcgatccttcaccaatgtcaactcc
aggatgctctacttcgcccctgatctggttttcaatgagtaccgcatgcacaagtcccgg
atgtacagccagtgtgtccgaatgaggcacctctctcaagagtttggatggctccaaatc
accccccaggaattcctgtgcatgaaagcactgctactcttcagcattattccagtggat
gggctgaaaaatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgat
cgtatcattgcatgcaaaagaaaaaatcccacatcctgctcaagacgcttctaccagctc
accaagctcctggactccgtgcagcctattgcgagagagctgcatcagttcacttttgac
ctgctaatcaagtcacacatggtgagcgtggactttccggaaatgatggcagagatcatc
tctgtgcaagtgcccaagatcctttctgggaaagtcaagcccatctatttccacacccag
tga

DBGET integrated database retrieval system