KEGG   Homo sapiens (human): 3718Help
Entry
3718              CDS       T01001                                 

Gene name
JAK3, JAK-3, JAK3_HUMAN, JAKL, L-JAK, LJAK
Definition
(RefSeq) Janus kinase 3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05223  Non-small cell lung cancer
hsa05340  Primary immunodeficiency
Network
nt06119  JAK-STAT signaling (virus)
nt06123  TNF signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00486  EBV LMP1 to Jak-STAT signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
Drug target
Atiprimod (DG02069): D03003 D03004
Decernotinib: D10585
Delgocitinib: D11046
Peficitinib (DG01853): D10653 D10721
Tofacitinib (DG00742): D09783 D09970
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3718 (JAK3)
   04151 PI3K-Akt signaling pathway
    3718 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3718 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3718 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3718 (JAK3)
   04659 Th17 cell differentiation
    3718 (JAK3)
   04062 Chemokine signaling pathway
    3718 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3718 (JAK3)
   05203 Viral carcinogenesis
    3718 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    3718 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    3718 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3718 (JAK3)
   05162 Measles
    3718 (JAK3)
   05161 Hepatitis B
    3718 (JAK3)
   05169 Epstein-Barr virus infection
    3718 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3718 (JAK3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3718 (JAK3)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   3718 (JAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 FERM_F1 Jak1_Phl Kdo APH SH2 LRR_RI_capping Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3718
NCBI-ProteinID: NP_000206
OMIM: 600173
HGNC: 6193
Ensembl: ENSG00000105639
Vega: OTTHUMG00000165648
Pharos: P52333(Tclin)
UniProt: P52333 A0A024R7M7
LinkDB All DBs
Structure
PDB: 

Position
19p13.11
AA seq 1124 aa AA seqDB search
MAPPSEETPLIPQRSCSLLSTEAGALHVLLPARGPGPPQRLSFSFGDHLAEDLCVQAAKA
SGILPVYHSLFALATEDLSCWFPPSHIFSVEDASTQVLLYRIRFYFPNWFGLEKCHRFGL
RKDLASAILDLPVLEHLFAQHRSDLVSGRLPVGLSLKEQGECLSLAVLDLARMAREQAQR
PGELLKTVSYKACLPPSLRDLIQGLSFVTRRRIRRTVRRALRRVAACQADRHSLMAKYIM
DLERLDPAGAAETFHVGLPGALGGHDGLGLLRVAGDGGIAWTQGEQEVLQPFCDFPEIVD
ISIKQAPRVGPAGEHRLVTVTRTDNQILEAEFPGLPEALSFVALVDGYFRLTTDSQHFFC
KEVAPPRLLEEVAEQCHGPITLDFAINKLKTGGSRPGSYVLRRSPQDFDSFLLTVCVQNP
LGPDYKGCLIRRSPTGTFLLVGLSRPHSSLRELLATCWDGGLHVDGVAVTLTSCCIPRPK
EKSNLIVVQRGHSPPTSSLVQPQSQYQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARKTEVLLKVMDAKHKNCMESFLEAASLMSQVSYRHLVLLHGVCMAGDSTMVQ
EFVHLGAIDMYLRKRGHLVPASWKLQVVKQLAYALNYLEDKGLPHGNVSARKVLLAREGA
DGSPPFIKLSDPGVSPAVLSLEMLTDRIPWVAPECLREAQTLSLEADKWGFGATVWEVFS
GVTMPISALDPAKKLQFYEDRQQLPAPKWTELALLIQQCMAYEPVQRPSFRAVIRDLNSL
ISSDYELLSDPTPGALAPRDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPDQQRDFQREIQILKALHSDFIVKYRGVSYGPGRQSLRL
VMEYLPSGCLRDFLQRHRARLDASRLLLYSSQICKGMEYLGSRRCVHRDLAARNILVESE
AHVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYCDKSCSPSAEFLRMMGCERDVPALCRLLELLEEGQRLPAPPACPAEVHELMKLCWAP
SPQDRPSFSALGPQLDMLWSGSRGCETHAFTAHPEGKHHSLSFS
NT seq 3375 nt NT seq  +upstreamnt  +downstreamnt
atggcacctccaagtgaagagacgcccctgatccctcagcgttcatgcagcctcttgtcc
acggaggctggtgccctgcatgtgctgctgcccgctcggggccccgggcccccccagcgc
ctatctttctcctttggggaccacttggctgaggacctgtgcgtgcaggctgccaaggcc
agcggcatcctgcctgtgtaccactccctctttgctctggccacggaggacctgtcctgc
tggttccccccgagccacatcttctccgtggaggatgccagcacccaagtcctgctgtac
aggattcgcttttacttccccaattggtttgggctggagaagtgccaccgcttcgggcta
cgcaaggatttggccagtgctatccttgacctgccagtcctggagcacctctttgcccag
caccgcagtgacctggtgagtgggcgcctccccgtgggcctcagtctcaaggagcagggt
gagtgtctcagcctggccgtgttggacctggcccggatggcgcgagagcaggcccagcgg
ccgggagagctgctgaagactgtcagctacaaggcctgcctacccccaagcctgcgcgac
ctgatccagggcctgagcttcgtgacgcggaggcgtattcggaggacggtgcgcagagcc
ctgcgccgcgtggccgcctgccaggcagaccggcactcgctcatggccaagtacatcatg
gacctggagcggctggatccagccggggccgccgagaccttccacgtgggcctccctggg
gcccttggtggccacgacgggctggggctgctccgcgtggctggtgacggcggcatcgcc
tggacccagggagaacaggaggtcctccagcccttctgcgactttccagaaatcgtagac
attagcatcaagcaggccccgcgcgttggcccggccggagagcaccgcctggtcactgtt
accaggacagacaaccagattttagaggccgagttcccagggctgcccgaggctctgtcg
ttcgtggcgctcgtggacggctacttccggctgaccacggactcccagcacttcttctgc
aaggaggtggcaccgccgaggctgctggaggaagtggccgagcagtgccacggccccatc
actctggactttgccatcaacaagctcaagactgggggctcacgtcctggctcctatgtt
ctccgccgcagcccccaggactttgacagcttcctcctcactgtctgtgtccagaacccc
cttggtcctgattataagggctgcctcatccggcgcagccccacaggaaccttccttctg
gttggcctcagccgaccccacagcagtcttcgagagctcctggcaacctgctgggatggg
gggctgcacgtagatggggtggcagtgaccctcacttcctgctgtatccccagacccaaa
gaaaagtccaacctgatcgtggtccagagaggtcacagcccacccacatcatccttggtt
cagccccaatcccaataccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggccatgggtccttcaccaagatttaccggggctgtcgc
catgaggtggtggatggggaggcccgaaagacagaggtgctgctgaaggtcatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcgagcttgatgagccaagtgtcg
taccggcatctcgtgctgctccacggcgtgtgcatggctggagacagcaccatggtgcag
gaatttgtacacctgggggccatagacatgtatctgcgaaaacgtggccacctggtgcca
gccagctggaagctgcaggtggtcaaacagctggcctacgccctcaactatctggaggac
aaaggcctgccccatggcaatgtctctgcccggaaggtgctcctggctcgggagggggct
gatgggagcccgcccttcatcaagctgagtgaccctggggtcagccccgctgtgttaagc
ctggagatgctcaccgacaggatcccctgggtggcccccgagtgtctccgggaggcgcag
acacttagcttggaagctgacaagtggggcttcggcgccacggtctgggaagtgtttagt
ggcgtcaccatgcccatcagtgccctggatcctgctaagaaactccaattttatgaggac
cggcagcagctgccggcccccaagtggacagagctggccctgctgattcaacagtgcatg
gcctatgagccggtccagaggccctccttccgagccgtcattcgtgacctcaatagcctc
atctcttcagactatgagctcctctcagaccccacacctggtgccctggcacctcgtgat
gggctgtggaatggtgcccagctctatgcctgccaagaccccacgatcttcgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagcgtggagctgtgccgc
tatgacccgctaggcgacaatacaggtgccctggtggccgtgaaacagctgcagcacagc
gggccagaccagcagagggactttcagcgggagattcagatcctcaaagcactgcacagt
gatttcattgtcaagtatcgtggtgtcagctatggcccgggccgccagagcctgcggctg
gtcatggagtacctgcccagcggctgcttgcgcgacttcctgcagcggcaccgcgcgcgc
ctcgatgccagccgcctccttctctattcctcgcagatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggccgcccgaaacatcctcgtggagagcgag
gcacacgtcaagatcgctgacttcggcctagctaagctgctgccgcttgacaaagactac
tacgtggtccgcgagccaggccagagccccattttctggtatgcccccgaatccctctcg
gacaacatcttctctcgccagtcagacgtctggagcttcggggtcgtcctgtacgagctc
ttcacctactgcgacaaaagctgcagcccctcggccgagttcctgcggatgatgggatgt
gagcgggatgtccccgccctctgccgcctcttggaactgctggaggagggccagaggctg
ccggcgcctcctgcctgccctgctgaggttcacgagctcatgaagctgtgctgggcccct
agcccacaggaccggccatcattcagcgccctgggcccccagctggacatgctgtggagc
ggaagccgggggtgtgagactcatgccttcactgctcacccagagggcaaacaccactcc
ctgtccttttcatag

DBGET integrated database retrieval system