KEGG   Homo sapiens (human): 472Help
Entry
472               CDS       T01001                                 

Gene name
ATM, AT1, ATA, ATC, ATD, ATDC, ATE, TEL1, TELO1
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03440  Homologous recombination
hsa04064  NF-kappa B signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04210  Apoptosis
hsa04218  Cellular senescence
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06240  Transcription
  Element
N00136  EWSR1-ATF1 fusion to transcriptional activation
N00347  p300-p21-Cell cycle G1/S
N00372  HPV E7 to p300-p21-Cell cycle G1/S
N00455  CDC25-Cell cycle G2/M
N00499  ATR-p21-Cell cycle G2/M
Disease
H00005  Chronic lymphocytic leukemia
H00064  Ataxia telangiectasia
H00094  Immunodeficiency associated with DNA repair defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    472 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    472 (ATM)
   04068 FoxO signaling pathway
    472 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    472 (ATM)
   04210 Apoptosis
    472 (ATM)
   04115 p53 signaling pathway
    472 (ATM)
   04218 Cellular senescence
    472 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    472 (ATM)
   05206 MicroRNAs in cancer
    472 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    472 (ATM)
   05170 Human immunodeficiency virus 1 infection
    472 (ATM)
   05165 Human papillomavirus infection
    472 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    472 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    472 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    472 (ATM)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    472 (ATM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     472 (ATM)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   472 (ATM)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     472 (ATM)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    472 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC ANAPC5
Motif
Other DBs
NCBI-GeneID: 472
NCBI-ProteinID: NP_000042
OMIM: 607585
HGNC: 795
Ensembl: ENSG00000149311
Vega: OTTHUMG00000166480
Pharos: Q13315(Tchem)
UniProt: Q13315 A0A024R3C7
LinkDB All DBs
Structure
PDB: 

Position
11q22.3
AA seq 3056 aa AA seqDB search
MSLVLNDLLICCRQLEHDRATERKKEVEKFKRLIRDPETIKHLDRHSDSKQGKYLNWDAV
FRFLQKYIQKETECLRIAKPNVSASTQASRQKKMQEISSLVKYFIKCANRRAPRLKCQEL
LNYIMDTVKDSSNGAIYGADCSNILLKDILSVRKYWCEISQQQWLELFSVYFRLYLKPSQ
DVHRVLVARIIHAVTKGCCSQTDGLNSKFLDFFSKAIQCARQEKSSSGLNHILAALTIFL
KTLAVNFRIRVCELGDEILPTLLYIWTQHRLNDSLKEVIIELFQLQIYIHHPKGAKTQEK
GAYESTKWRSILYNLYDLLVNEISHIGSRGKYSSGFRNIAVKENLIELMADICHQVFNED
TRSLEISQSYTTTQRESSDYSVPCKRKKIELGWEVIKDHLQKSQNDFDLVPWLQIATQLI
SKYPASLPNCELSPLLMILSQLLPQQRHGERTPYVLRCLTEVALCQDKRSNLESSQKSDL
LKLWNKIWCITFRGISSEQIQAENFGLLGAIIQGSLVEVDREFWKLFTGSACRPSCPAVC
CLTLALTTSIVPGTVKMGIEQNMCEVNRSFSLKESIMKWLLFYQLEGDLENSTEVPPILH
SNFPHLVLEKILVSLTMKNCKAAMNFFQSVPECEHHQKDKEELSFSEVEELFLQTTFDKM
DFLTIVRECGIEKHQSSIGFSVHQNLKESLDRCLLGLSEQLLNNYSSEITNSETLVRCSR
LLVGVLGCYCYMGVIAEEEAYKSELFQKAKSLMQCAGESITLFKNKTNEEFRIGSLRNMM
QLCTRCLSNCTKKSPNKIASGFFLRLLTSKLMNDIADICKSLASFIKKPFDRGEVESMED
DTNGNLMEVEDQSSMNLFNDYPDSSVSDANEPGESQSTIGAINPLAEEYLSKQDLLFLDM
LKFLCLCVTTAQTNTVSFRAADIRRKLLMLIDSSTLEPTKSLHLHMYLMLLKELPGEEYP
LPMEDVLELLKPLSNVCSLYRRDQDVCKTILNHVLHVVKNLGQSNMDSENTRDAQGQFLT
VIGAFWHLTKERKYIFSVRMALVNCLKTLLEADPYSKWAILNVMGKDFPVNEVFTQFLAD
NHHQVRMLAAESINRLFQDTKGDSSRLLKALPLKLQQTAFENAYLKAQEGMREMSHSAEN
PETLDEIYNRKSVLLTLIAVVLSCSPICEKQALFALCKSVKENGLEPHLVKKVLEKVSET
FGYRRLEDFMASHLDYLVLEWLNLQDTEYNLSSFPFILLNYTNIEDFYRSCYKVLIPHLV
IRSHFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEGTRDSGMAQQRETATKVYD
MLKSENLLGKQIDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAPNPPH
FPSHVIKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILK
IYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQRPSCIMDVSLRSFSLCCDLLSQ
VCQTAVTYCKDALENHLHVIVGTLIPLVYEQVEVQKQVLDLLKYLVIDNKDNENLYITIK
LLDPFPDHVVFKDLRITQQKIKYSRGPFSLLEEINHFLSVSVYDALPLTRLEGLKDLRRQ
LELHKDQMVDIMRASQDNPQDGIMVKLVVNLLQLSKMAINHTGEKEVLEAVGSCLGEVGP
IDFSTIAIQHSKDASYTKALKLFEDKELQWTFIMLTYLNNTLVEDCVKVRSAAVTCLKNI
LATKTGHSFWEIYKMTTDPMLAYLQPFRTSRKKFLEVPRFDKENPFEGLDDINLWIPLSE
NHDIWIKTLTCAFLDSGGTKCEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWRN
LLSTHVQGFFTSCLRHFSQTSRSTTPANLDSESEHFFRCCLDKKSQRTMLAVVDYMRRQK
RPSSGTIFNDAFWLDLNYLEVAKVAQSCAAHFTALLYAEIYADKKSMDDQEKRSLAFEEG
SQSTTISSLSEKSKEETGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPITRLRTYEHEA
MWGKALVTYDLETAIPSSTRQAGIIQALQNLGLCHILSVYLKGLDYENKDWCPELEELHY
QAAWRNMQWDHCTSVSKEVEGTSYHESLYNALQSLRDREFSTFYESLKYARVKEVEEMCK
RSLESVYSLYPTLSRLQAIGELESIGELFSRSVTHRQLSEVYIKWQKHSQLLKDSDFSFQ
EPIMALRTVILEILMEKEMDNSQRECIKDILTKHLVELSILARTFKNTQLPERAIFQIKQ
YNSVSCGVSEWQLEEAQVFWAKKEQSLALSILKQMIKKLDASCAANNPSLKLTYTECLRV
CGNWLAETCLENPAVIMQTYLEKAVEVAGNYDGESSDELRNGKMKAFLSLARFSDTQYQR
IENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRK
RFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLM
YQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARR
SRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKT
QRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPK
IIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTICTYKVVPL
SQRSGVLEWCTGTVPIGEFLVNNEDGAHKRYRPNDFSAFQCQKKMMEVQKKSFEEKYEVF
MDVCQNFQPVFRYFCMEKFLDPAIWFEKRLAYTRSVATSSIVGYILGLGDRHVQNILINE
QSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCEKTMEVMRN
SQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQ
SFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAIDPKNLSRLFPGWKAWV
NT seq 9171 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagtacttaatgatctgcttatctgctgccgtcaactagaacatgatagagct
acagaacgaaagaaagaagttgagaaatttaagcgcctgattcgagatcctgaaacaatt
aaacatctagatcggcattcagattccaaacaaggaaaatatttgaattgggatgctgtt
tttagatttttacagaaatatattcagaaagaaacagaatgtctgagaatagcaaaacca
aatgtatcagcctcaacacaagcctccaggcagaaaaagatgcaggaaatcagtagtttg
gtcaaatacttcatcaaatgtgcaaacagaagagcacctaggctaaaatgtcaagaactc
ttaaattatatcatggatacagtgaaagattcatctaatggtgctatttacggagctgat
tgtagcaacatactactcaaagacattctttctgtgagaaaatactggtgtgaaatatct
cagcaacagtggttagaattgttctctgtgtacttcaggctctatctgaaaccttcacaa
gatgttcatagagttttagtggctagaataattcatgctgttaccaaaggatgctgttct
cagactgacggattaaattccaaatttttggactttttttccaaggctattcagtgtgcg
agacaagaaaagagctcttcaggtctaaatcatatcttagcagctcttactatcttcctc
aagactttggctgtcaactttcgaattcgagtgtgtgaattaggagatgaaattcttccc
actttgctttatatttggactcaacataggcttaatgattctttaaaagaagtcattatt
gaattatttcaactgcaaatttatatccatcatccgaaaggagccaaaacccaagaaaaa
ggtgcttatgaatcaacaaaatggagaagtattttatacaacttatatgatctgctagtg
aatgagataagtcatataggaagtagaggaaagtattcttcaggatttcgtaatattgcc
gtcaaagaaaatttgattgaattgatggcagatatctgtcaccaggtttttaatgaagat
accagatccttggagatttctcaatcttacactactacacaaagagaatctagtgattac
agtgtcccttgcaaaaggaagaaaatagaactaggctgggaagtaataaaagatcacctt
cagaagtcacagaatgattttgatcttgtgccttggctacagattgcaacccaattaata
tcaaagtatcctgcaagtttacctaactgtgagctgtctccattactgatgatactatct
cagcttctaccccaacagcgacatggggaacgtacaccatatgtgttacgatgccttacg
gaagttgcattgtgtcaagacaagaggtcaaacctagaaagctcacaaaagtcagattta
ttaaaactctggaataaaatttggtgtattacctttcgtggtataagttctgagcaaata
caagctgaaaactttggcttacttggagccataattcagggtagtttagttgaggttgac
agagaattctggaagttatttactgggtcagcctgcagaccttcatgtcctgcagtatgc
tgtttgactttggcactgaccaccagtatagttccaggaacggtaaaaatgggaatagag
caaaatatgtgtgaagtaaatagaagcttttctttaaaggaatcaataatgaaatggctc
ttattctatcagttagagggtgacttagaaaatagcacagaagtgcctccaattcttcac
agtaattttcctcatcttgtactggagaaaattcttgtgagtctcactatgaaaaactgt
aaagctgcaatgaattttttccaaagcgtgccagaatgtgaacaccaccaaaaagataaa
gaagaactttcattctcagaagtagaagaactatttcttcagacaacttttgacaagatg
gactttttaaccattgtgagagaatgtggtatagaaaagcaccagtccagtattggcttc
tctgtccaccagaatctcaaggaatcactggatcgctgtcttctgggattatcagaacag
cttctgaataattactcatctgagattacaaattcagaaactcttgtccggtgttcacgt
cttttggtgggtgtccttggctgctactgttacatgggtgtaatagctgaagaggaagca
tataagtcagaattattccagaaagccaagtctctaatgcaatgtgcaggagaaagtatc
actctgtttaaaaataagacaaatgaggaattcagaattggttccttgagaaatatgatg
cagctatgtacacgttgcttgagcaactgtaccaagaagagtccaaataagattgcatct
ggctttttcctgcgattgttaacatcaaagctaatgaatgacattgcagatatttgtaaa
agtttagcatccttcatcaaaaagccatttgaccgtggagaagtagaatcaatggaagat
gatactaatggaaatctaatggaggtggaggatcagtcatccatgaatctatttaacgat
taccctgatagtagtgttagtgatgcaaacgaacctggagagagccaaagtaccataggt
gccattaatcctttagctgaagaatatctgtcaaagcaagatctacttttcttagacatg
ctcaagttcttgtgtttgtgtgtaactactgctcagaccaatactgtgtcctttagggca
gctgatattcggaggaaattgttaatgttaattgattctagcacgctagaacctaccaaa
tccctccacctgcatatgtatctaatgcttttaaaggagcttcctggagaagagtacccc
ttgccaatggaagatgttcttgaacttctgaaaccactatccaatgtgtgttctttgtat
cgtcgtgaccaagatgtttgtaaaactattttaaaccatgtccttcatgtagtgaaaaac
ctaggtcaaagcaatatggactctgagaacacaagggatgctcaaggacagtttcttaca
gtaattggagcattttggcatctaacaaaggagaggaaatatatattctctgtaagaatg
gccctagtaaattgccttaaaactttgcttgaggctgatccttattcaaaatgggccatt
cttaatgtaatgggaaaagactttcctgtaaatgaagtatttacacaatttcttgctgac
aatcatcaccaagttcgcatgttggctgcagagtcaatcaatagattgttccaggacacg
aagggagattcttccaggttactgaaagcacttcctttgaagcttcagcaaacagctttt
gaaaatgcatacttgaaagctcaggaaggaatgagagaaatgtcccatagtgctgagaac
cctgaaactttggatgaaatttataatagaaaatctgttttactgacgttgatagctgtg
gttttatcctgtagccctatctgcgaaaaacaggctttgtttgccctgtgtaaatctgtg
aaagagaatggattagaacctcaccttgtgaaaaaggttttagagaaagtttctgaaact
tttggatatagacgtttagaagactttatggcatctcatttagattatctggttttggaa
tggctaaatcttcaagatactgaatacaacttatcttcttttccttttattttattaaac
tacacaaatattgaggatttctatagatcttgttataaggttttgattccacatctggtg
attagaagtcattttgatgaggtgaagtccattgctaatcagattcaagaggactggaaa
agtcttctaacagactgctttccaaagattcttgtaaatattcttccttattttgcctat
gagggtaccagagacagtgggatggcacagcaaagagagactgctaccaaggtctatgat
atgcttaaaagtgaaaacttattgggaaaacagattgatcacttattcattagtaattta
ccagagattgtggtggagttattgatgacgttacatgagccagcaaattctagtgccagt
cagagcactgacctctgtgacttttcaggggatttggatcctgctcctaatccacctcat
tttccatcgcatgtgattaaagcaacatttgcctatatcagcaattgtcataaaaccaag
ttaaaaagcattttagaaattctttccaaaagccctgattcctatcagaaaattcttctt
gccatatgtgagcaagcagctgaaacaaataatgtttataagaagcacagaattcttaaa
atatatcacctgtttgttagtttattactgaaagatataaaaagtggcttaggaggagct
tgggcctttgttcttcgagacgttatttatactttgattcactatatcaaccaaaggcct
tcttgtatcatggatgtgtcattacgtagcttctccctttgttgtgacttattaagtcag
gtttgccagacagccgtgacttactgtaaggatgctctagaaaaccatcttcatgttatt
gttggtacacttataccccttgtgtatgagcaggtggaggttcagaaacaggtattggac
ttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatcacgattaag
cttttagatccttttcctgaccatgttgtttttaaggatttgcgtattactcagcaaaaa
atcaaatacagtagaggacccttttcactcttggaggaaattaaccattttctctcagta
agtgtttatgatgcacttccattgacaagacttgaaggactaaaggatcttcgaagacaa
ctggaactacataaagatcagatggtggacattatgagagcttctcaggataatccgcaa
gatgggattatggtgaaactagttgtcaatttgttgcagttatccaagatggcaataaac
cacactggtgaaaaagaagttctagaggctgttggaagctgcttgggagaagtgggtcct
atagatttctctaccatagctatacaacatagtaaagatgcatcttataccaaggccctt
aagttatttgaagataaagaacttcagtggaccttcataatgctgacctacctgaataac
acactggtagaagattgtgtcaaagttcgatcagcagctgttacctgtttgaaaaacatt
ttagccacaaagactggacatagtttctgggagatttataagatgacaacagatccaatg
ctggcctatctacagccttttagaacatcaagaaaaaagtttttagaagtacccagattt
gacaaagaaaacccttttgaaggcctggatgatataaatctgtggattcctctaagtgaa
aatcatgacatttggataaagacactgacttgtgcttttttggacagtggaggcacaaaa
tgtgaaattcttcaattattaaagccaatgtgtgaagtgaaaactgacttttgtcagact
gtacttccatacttgattcatgatattttactccaagatacaaatgaatcatggagaaat
ctgctttctacacatgttcagggatttttcaccagctgtcttcgacacttctcgcaaacg
agccgatccacaacccctgcaaacttggattcagagtcagagcactttttccgatgctgt
ttggataaaaaatcacaaagaacaatgcttgctgttgtggactacatgagaagacaaaag
agaccttcttcaggaacaatttttaatgatgctttctggctggatttaaattatctagaa
gttgccaaggtagctcagtcttgtgctgctcactttacagctttactctatgcagaaatc
tatgcagataagaaaagtatggatgatcaagagaaaagaagtcttgcatttgaagaagga
agccagagtacaactatttctagcttgagtgaaaaaagtaaagaagaaactggaataagt
ttacaggatcttctcttagaaatctacagaagtataggggagccagatagtttgtatggc
tgtggtggagggaagatgttacaacccattactagactacgaacatatgaacacgaagca
atgtggggcaaagccctagtaacatatgacctcgaaacagcaatcccctcatcaacacgc
caggcaggaatcattcaggccttgcagaatttgggactctgccatattctttccgtctat
ttaaaaggattggattatgaaaataaagactggtgtcctgaactagaagaacttcattac
caagcagcatggaggaatatgcagtgggaccattgcacttccgtcagcaaagaagtagaa
ggaaccagttaccatgaatcattgtacaatgctctacaatctctaagagacagagaattc
tctacattttatgaaagtctcaaatatgccagagtaaaagaagtggaagagatgtgtaag
cgcagccttgagtctgtgtattcgctctatcccacacttagcaggttgcaggccattgga
gagctggaaagcattggggagcttttctcaagatcagtcacacatagacaactctctgaa
gtatatattaagtggcagaaacactcccagcttctcaaggacagtgattttagttttcag
gagcctatcatggctctacgcacagtcattttggagatcctgatggaaaaggaaatggac
aactcacaaagagaatgtattaaggacattctcaccaaacaccttgtagaactctctata
ctggccagaactttcaagaacactcagctccctgaaagggcaatatttcaaattaaacag
tacaattcagttagctgtggagtctctgagtggcagctggaagaagcacaagtattctgg
gcaaaaaaggagcagagtcttgccctgagtattctcaagcaaatgatcaagaagttggat
gccagctgtgcagcgaacaatcccagcctaaaacttacatacacagaatgtctgagggtt
tgtggcaactggttagcagaaacgtgcttagaaaatcctgcggtcatcatgcagacctat
ctagaaaaggcagtagaagttgctggaaattatgatggagaaagtagtgatgagctaaga
aatggaaaaatgaaggcatttctctcattagcccggttttcagatactcaataccaaaga
attgaaaactacatgaaatcatcggaatttgaaaacaagcaagctctcctgaaaagagcc
aaagaggaagtaggtctccttagggaacataaaattcagacaaacagatacacagtaaag
gttcagcgagagctggagttggatgaattagccctgcgtgcactgaaagaggatcgtaaa
cgcttcttatgtaaagcagttgaaaattatatcaactgcttattaagtggagaagaacat
gatatgtgggtattccgactttgttccctctggcttgaaaattctggagtttctgaagtc
aatggcatgatgaagagagacggaatgaagattccaacatataaatttttgcctcttatg
taccaattggctgctagaatggggaccaagatgatgggaggcctaggatttcatgaagtc
ctcaataatctaatctctagaatttcaatggatcacccccatcacactttgtttattata
ctggccttagcaaatgcaaacagagatgaatttctgactaaaccagaggtagccagaaga
agcagaataactaaaaatgtgcctaaacaaagctctcagcttgatgaggatcgaacagag
gctgcaaatagaataatatgtactatcagaagtaggagacctcagatggtcagaagtgtt
gaggcactttgtgatgcttatattatattagcaaacttagatgccactcagtggaagact
cagagaaaaggcataaatattccagcagaccagccaattactaaacttaagaatttagaa
gatgttgttgtccctactatggaaattaaggtggaccacacaggagaatatggaaatctg
gtgactatacagtcatttaaagcagaatttcgcttagcaggaggtgtaaatttaccaaaa
ataatagattgtgtaggttccgatggcaaggagaggagacagcttgttaagggccgtgat
gacctgagacaagatgctgtcatgcaacaggtcttccagatgtgtaatacattactgcag
agaaacacggaaactaggaagaggaaattaactatctgtacttataaggtggttcccctc
tctcagcgaagtggtgttcttgaatggtgcacaggaactgtccccattggtgaatttctt
gttaacaatgaagatggtgctcataaaagatacaggccaaatgatttcagtgcctttcag
tgccaaaagaaaatgatggaggtgcaaaaaaagtcttttgaagagaaatatgaagtcttc
atggatgtttgccaaaattttcaaccagttttccgttacttctgcatggaaaaattcttg
gatccagctatttggtttgagaagcgattggcttatacgcgcagtgtagctacttcttct
attgttggttacatacttggacttggtgatagacatgtacagaatatcttgataaatgag
cagtcagcagaacttgtacatatagatctaggtgttgcttttgaacagggcaaaatcctt
cctactcctgagacagttccttttagactcaccagagatattgtggatggcatgggcatt
acgggtgttgaaggtgtcttcagaagatgctgtgagaaaaccatggaagtgatgagaaac
tctcaggaaactctgttaaccattgtagaggtccttctatatgatccactctttgactgg
accatgaatcctttgaaagctttgtatttacagcagaggccggaagatgaaactgagctt
caccctactctgaatgcagatgaccaagaatgcaaacgaaatctcagtgatattgaccag
agtttcaacaaagtagctgaacgtgtcttaatgagactacaagagaaactgaaaggagtg
gaagaaggcactgtgctcagtgttggtggacaagtgaatttgctcatacagcaggccata
gaccccaaaaatctcagccgacttttcccaggatggaaagcttgggtgtga

KEGG   Homo sapiens (human): 545Help
Entry
545               CDS       T01001                                 

Gene name
ATR, FCTCS, FRP1, MEC1, SCKL, SCKL1
Definition
(RefSeq) ATR serine/threonine kinase
  KO
K06640  serine/threonine-protein kinase ATR [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa04110  Cell cycle
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06130  Cell cycle (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
  Element
N00347  p300-p21-Cell cycle G1/S
N00455  CDC25-Cell cycle G2/M
N00456  HIV Vpr to CDC25-cell cycle G2M
N00459  WEE1-Cell cycle G2/M
N00499  ATR-p21-Cell cycle G2/M
Disease
H00037  Rhabdomyosarcoma
H00992  Seckel syndrome
Drug target
Berzosertib: D11148
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    545 (ATR)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    545 (ATR)
   04115 p53 signaling pathway
    545 (ATR)
   04218 Cellular senescence
    545 (ATR)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    545 (ATR)
   05170 Human immunodeficiency virus 1 infection
    545 (ATR)
   05165 Human papillomavirus infection
    545 (ATR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    545 (ATR)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    545 (ATR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     545 (ATR)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   545 (ATR)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    545 (ATR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT UME FATC Mad3_BUB1_I TPR_1 THP2
Motif
Other DBs
NCBI-GeneID: 545
NCBI-ProteinID: NP_001175
OMIM: 601215
HGNC: 882
Ensembl: ENSG00000175054
Vega: OTTHUMG00000159234
Pharos: Q13535(Tchem)
UniProt: Q13535
LinkDB All DBs
Structure
PDB: 

Position
3q23
AA seq 2644 aa AA seqDB search
MGEHGLELASMIPALRELGSATPEEYNTVVQKPRQILCQFIDRILTDVNVVAVELVKKTD
SQPTSVMLLDFIQHIMKSSPLMFVNVSGSHEAKGSCIEFSNWIITRLLRIAATPSCHLLH
KKICEVICSLLFLFKSKSPAIFGVLTKELLQLFEDLVYLHRRNVMGHAVEWPVVMSRFLS
QLDEHMGYLQSAPLQLMSMQNLEFIEVTLLMVLTRIIAIVFFRRQELLLWQIGCVLLEYG
SPKIKSLAISFLTELFQLGGLPAQPASTFFSSFLELLKHLVEMDTDQLKLYEEPLSKLIK
TLFPFEAEAYRNIEPVYLNMLLEKLCVMFEDGVLMRLKSDLLKAALCHLLQYFLKFVPAG
YESALQVRKVYVRNICKALLDVLGIEVDAEYLLGPLYAALKMESMEIIEEIQCQTQQENL
SSNSDGISPKRRRLSSSLNPSKRAPKQTEEIKHVDMNQKSILWSALKQKAESLQISLEYS
GLKNPVIEMLEGIAVVLQLTALCTVHCSHQNMNCRTFKDCQHKSKKKPSVVITWMSLDFY
TKVLKSCRSLLESVQKLDLEATIDKVVKIYDALIYMQVNSSFEDHILEDLCGMLSLPWIY
SHSDDGCLKLTTFAANLLTLSCRISDSYSPQAQSRCVFLLTLFPRRIFLEWRTAVYNWAL
QSSHEVIRASCVSGFFILLQQQNSCNRVPKILIDKVKDDSDIVKKEFASILGQLVCTLHG
MFYLTSSLTEPFSEHGHVDLFCRNLKATSQHECSSSQLKASVCKPFLFLLKKKIPSPVKL
AFIDNLHHLCKHLDFREDETDVKAVLGTLLNLMEDPDKDVRVAFSGNIKHILESLDSEDG
FIKELFVLRMKEAYTHAQISRNNELKDTLILTTGDIGRAAKGDLVPFALLHLLHCLLSKS
ASVSGAAYTEIRALVAAKSVKLQSFFSQYKKPICQFLVESLHSSQMTALPNTPCQNADVR
KQDVAHQREMALNTLSEIANVFDFPDLNRFLTRTLQVLLPDLAAKASPAASALIRTLGKQ
LNVNRREILINNFKYIFSHLVCSCSKDELERALHYLKNETEIELGSLLRQDFQGLHNELL
LRIGEHYQQVFNGLSILASFASSDDPYQGPRDIISPELMADYLQPKLLGILAFFNMQLLS
SSVGIEDKKMALNSLMSLMKLMGPKHVSSVRVKMMTTLRTGLRFKDDFPELCCRAWDCFV
RCLDHACLGSLLSHVIVALLPLIHIQPKETAAIFHYLIIENRDAVQDFLHEIYFLPDHPE
LKKIKAVLQEYRKETSESTDLQTTLQLSMKAIQHENVDVRIHALTSLKETLYKNQEKLIK
YATDSETVEPIISQLVTVLLKGCQDANSQARLLCGECLGELGAIDPGRLDFSTTETQGKD
FTFVTGVEDSSFAYGLLMELTRAYLAYADNSRAQDSAAYAIQELLSIYDCREMETNGPGH
QLWRRFPEHVREILEPHLNTRYKSSQKSTDWSGVKKPIYLSKLGSNFAEWSASWAGYLIT
KVRHDLASKIFTCCSIMMKHDFKVTIYLLPHILVYVLLGCNQEDQQEVYAEIMAVLKHDD
QHTINTQDIASDLCQLSTQTVFSMLDHLTQWARHKFQALKAEKCPHSKSNRNKVDSMVST
VDYEDYQSVTRFLDLIPQDTLAVASFRSKAYTRAVMHFESFITEKKQNIQEHLGFLQKLY
AAMHEPDGVAGVSAIRKAEPSLKEQILEHESLGLLRDATACYDRAIQLEPDQIIHYHGVV
KSMLGLGQLSTVITQVNGVHANRSEWTDELNTYRVEAAWKLSQWDLVENYLAADGKSTTW
SVRLGQLLLSAKKRDITAFYDSLKLVRAEQIVPLSAASFERGSYQRGYEYIVRLHMLCEL
EHSIKPLFQHSPGDSSQEDSLNWVARLEMTQNSYRAKEPILALRRALLSLNKRPDYNEMV
GECWLQSARVARKAGHHQTAYNALLNAGESRLAELYVERAKWLWSKGDVHQALIVLQKGV
ELCFPENETPPEGKNMLIHGRAMLLVGRFMEETANFESNAIMKKYKDVTACLPEWEDGHF
YLAKYYDKLMPMVTDNKMEKQGDLIRYIVLHFGRSLQYGNQFIYQSMPRMLTLWLDYGTK
AYEWEKAGRSDRVQMRNDLGKINKVITEHTNYLAPYQFLTAFSQLISRICHSHDEVFVVL
MEIIAKVFLAYPQQAMWMMTAVSKSSYPMRVNRCKEILNKAIHMKKSLEKFVGDATRLTD
KLLELCNKPVDGSSSTLSMSTHFKMLKKLVEEATFSEILIPLQSVMIPTLPSILGTHANH
ASHEPFPGHWAYIAGFDDMVEILASLQKPKKISLKGSDGKFYIMMCKPKDDLRKDCRLME
FNSLINKCLRKDAESRRRELHIRTYAVIPLNDECGIIEWVNNTAGLRPILTKLYKEKGVY
MTGKELRQCMLPKSAALSEKLKVFREFLLPRHPPIFHEWFLRTFPDPTSWYSSRSAYCRS
TAVMSMVGYILGLGDRHGENILFDSLTGECVHVDFNCLFNKGETFEVPEIVPFRLTHNMV
NGMGPMGTEGLFRRACEVTMRLMRDQREPLMSVLKTFLHDPLVEWSKPVKGHSKAPLNET
GEVVNEKAKTHVLDIEQRLQGVIKTRNRVTGLPLSIEGHVHYLIQEATDENLLCQMYLGW
TPYM
NT seq 7935 nt NT seq  +upstreamnt  +downstreamnt
atgggggaacatggcctggagctggcttccatgatccccgccctgcgggagctgggcagt
gccacaccagaggaatataatacagttgtacagaagccaagacaaattctgtgtcaattc
attgaccggatacttacagatgtaaatgttgttgctgtagaacttgtaaagaaaactgac
tctcagccaacctccgtgatgttgcttgatttcatccagcatatcatgaaatcctcccca
cttatgtttgtaaatgtgagtggaagccatgaggccaaaggcagttgtattgaattcagt
aattggatcataacgagacttctgcggattgcagcaactccctcctgtcatttgttacac
aagaaaatctgtgaagtcatctgttcattattatttctttttaaaagcaagagtcctgct
atttttggggtactcacaaaagaattattacaactttttgaagacttggtttacctccat
agaagaaatgtgatgggtcatgctgtggaatggccagtggtcatgagccgatttttaagt
caattagatgaacacatgggatatttacaatcagctcctttgcagttgatgagtatgcaa
aatttagaatttattgaagtcactttattaatggttcttactcgtattattgcaattgtg
ttttttagaaggcaagaactcttactttggcagataggttgtgttctgctagagtatggt
agtccaaaaattaaatccctagcaattagctttttaacagaactttttcagcttggagga
ctaccagcacaaccagctagcacttttttcagctcatttttggaattattaaaacacctt
gtagaaatggatactgaccaattgaaactctatgaagagccattatcaaagctgataaag
acactatttccctttgaagcagaagcttatagaaatattgaacctgtctatttaaatatg
ctgctggaaaaactctgtgtcatgtttgaagacggtgtgctcatgcggcttaagtctgat
ttgctaaaagcagctttgtgccatttactgcagtatttccttaaatttgtgccagctggg
tatgaatctgctttacaagtcaggaaggtctatgtgagaaatatttgtaaagctcttttg
gatgtgcttggaattgaggtagatgcagagtacttgttgggcccactttatgcagctttg
aaaatggaaagtatggaaatcattgaggagattcaatgccaaactcaacaggaaaacctc
agcagtaatagtgatggaatatcacccaaaaggcgtcgtctcagctcgtctctaaaccct
tctaaaagagcaccaaaacagactgaggaaattaaacatgtggacatgaaccaaaagagc
atattatggagtgcactgaaacagaaagctgaatcccttcagatttcccttgaatacagt
ggcctaaagaatcctgttattgagatgttagaaggaattgctgttgtcttacaactgact
gctctgtgtactgttcattgttctcatcaaaacatgaactgccgtactttcaaggactgt
caacataaatccaagaagaaaccttctgtagtgataacttggatgtcattggatttttac
acaaaagtgcttaagagctgtagaagtttgttagaatctgttcagaaactggacctggag
gcaaccattgataaggtggtgaaaatttatgatgctttgatttatatgcaagtaaacagt
tcatttgaagatcatatcctggaagatttatgtggtatgctctcacttccatggatttat
tcccattctgatgatggctgtttaaagttgaccacatttgccgctaatcttctaacatta
agctgtaggatttcagatagctattcaccacaggcacaatcacgatgtgtgtttcttctg
actctgtttccaagaagaatattccttgagtggagaacagcagtttacaactgggccctg
cagagctcccatgaagtaatccgggctagttgtgttagtggattttttatcttattgcag
cagcagaattcttgtaacagagttcccaagattcttatagataaagtcaaagatgattct
gacattgtcaagaaagaatttgcttctatacttggtcaacttgtctgtactcttcacggc
atgttttatctgacaagttctttaacagaacctttctctgaacacggacatgtggacctc
ttctgtaggaacttgaaagccacttctcaacatgaatgttcatcttctcaactaaaagct
tctgtctgcaagccattccttttcctactgaaaaaaaaaatacctagtccagtaaaactt
gctttcatagataatctacatcatctttgtaagcatcttgattttagagaagatgaaaca
gatgtaaaagcagttcttggaactttattaaatttaatggaagatccagacaaagatgtt
agagtggcttttagtggaaatatcaagcacatattggaatccttggactctgaagatgga
tttataaaggagctttttgtcttaagaatgaaggaagcatatacacatgcccaaatatca
agaaataatgagctgaaggataccttgattcttacaacaggggatattggaagggccgca
aaaggagatttggtaccatttgcactcttacacttattgcattgtttgttatccaagtca
gcatctgtctctggagcagcatacacagaaattagagctctggttgcagctaaaagtgtt
aaactgcaaagttttttcagccagtataagaaacccatctgtcagtttttggtagaatcc
cttcactctagtcagatgacagcacttccgaatactccatgccagaatgctgacgtgcga
aaacaagatgtggctcaccagagagaaatggctttaaatacgttgtctgaaattgccaac
gttttcgactttcctgatcttaatcgttttcttactaggacattacaagttctactacct
gatcttgctgccaaagcaagccctgcagcttctgctctcattcgaactttaggaaaacaa
ttaaatgtcaatcgtagagagattttaataaacaacttcaaatatattttttctcatttg
gtctgttcttgttccaaagatgaattagaacgtgcccttcattatctgaagaatgaaaca
gaaattgaactggggagcctgttgagacaagatttccaaggattgcataatgaattattg
ctgcgtattggagaacactatcaacaggtttttaatggtttgtcaatacttgcctcattt
gcatccagtgatgatccatatcagggcccgagagatatcatatcacctgaactgatggct
gattatttacaacccaaattgttgggcattttggctttttttaacatgcagttactgagc
tctagtgttggcattgaagataagaaaatggccttgaacagtttgatgtctttgatgaag
ttaatgggacccaaacatgtcagttctgtgagggtgaagatgatgaccacactgagaact
ggccttcgattcaaggatgattttcctgaattgtgttgcagagcttgggactgctttgtt
cgctgcctggatcatgcttgtctgggctcccttctcagtcatgtaatagtagctttgtta
cctcttatacacatccagcctaaagaaactgcagctatcttccactacctcataattgaa
aacagggatgctgtgcaagattttcttcatgaaatatattttttacctgatcatccagaa
ttaaaaaagataaaagccgttctccaggaatacagaaaggagacctctgagagcactgat
cttcagacaactcttcagctctctatgaaggccattcaacatgaaaatgtcgatgttcgt
attcatgctcttacaagcttgaaggaaaccttgtataaaaatcaggaaaaactgataaag
tatgcaacagacagtgaaacagtagaacctattatctcacagttggtgacagtgcttttg
aaaggttgccaagatgcaaactctcaagctcggttgctctgtggggaatgtttaggggaa
ttgggggcgatagatccaggtcgattagatttctcaacaactgaaactcaaggaaaagat
tttacatttgtgactggagtagaagattcaagctttgcctatggattattgatggagcta
acaagagcttaccttgcgtatgctgataatagccgagctcaagattcagctgcctatgcc
attcaggagttgctttctatttatgactgtagagagatggagaccaacggcccaggtcac
caattgtggaggagatttcctgagcatgttcgggaaatactagaacctcatctaaatacc
agatacaagagttctcagaagtcaaccgattggtctggagtaaagaagccaatttactta
agtaaattgggtagtaactttgcagaatggtcagcatcttgggcaggttatcttattaca
aaggttcgacatgatcttgccagtaaaattttcacctgctgtagcattatgatgaagcat
gatttcaaagtgaccatctatcttcttccacatattctggtgtatgtcttactgggttgt
aatcaagaagatcagcaggaggtttatgcagaaattatggcagttctaaagcatgacgat
cagcataccataaatacccaagacattgcatctgatctgtgtcaactcagtacacagact
gtgttctccatgcttgaccatctcacacagtgggcaaggcacaaatttcaggcactgaaa
gctgagaaatgtccacacagcaaatcaaacagaaataaggtagactcaatggtatctact
gtggattatgaagactatcagagtgtaacccgttttctagacctcataccccaggatact
ctggcagtagcttcctttcgctccaaagcatacacacgagctgtaatgcactttgaatca
tttattacagaaaagaagcaaaatattcaggaacatcttggatttttacagaaattgtat
gctgctatgcatgaacctgatggagtggccggagtcagtgcaattagaaaggcagaacca
tctctaaaagaacagatccttgaacatgaaagccttggcttgctgagggatgccactgct
tgttatgacagggctattcagctagaaccagaccagatcattcattatcatggtgtagta
aagtccatgttaggtcttggtcagctgtctactgttatcactcaggtgaatggagtgcat
gctaacaggtccgagtggacagatgaattaaacacgtacagagtggaagcagcttggaaa
ttgtcacagtgggatttggtggaaaactatttggcagcagatggaaaatctacaacatgg
agtgtcagactgggacagctattattatcagccaaaaaaagagatatcacagctttttat
gactcactgaaactagtgagagcagaacaaattgtacctctttcagctgcaagctttgaa
agaggctcctaccaacgaggatatgaatatattgtgagattgcacatgttatgtgagttg
gagcatagcatcaaaccacttttccagcattctccaggtgacagttctcaagaagattct
ctaaactgggtagctcgactagaaatgacccagaattcctacagagccaaggagcctatc
ctggctctccggagggctttactaagcctcaacaaaagaccagattacaatgaaatggtt
ggagaatgctggctgcagagtgccagggtagctagaaaggctggtcaccaccagacagcc
tacaatgctctccttaatgcaggggaatcacgactcgctgaactgtacgtggaaagggca
aagtggctctggtccaagggtgatgttcaccaggcactaattgttcttcaaaaaggtgtt
gaattatgttttcctgaaaatgaaaccccacctgagggtaagaacatgttaatccatggt
cgagctatgctactagtgggccgatttatggaagaaacagctaactttgaaagcaatgca
attatgaaaaaatataaggatgtgaccgcgtgcctgccagaatgggaggatgggcatttt
taccttgccaagtactatgacaaattgatgcccatggtcacagacaacaaaatggaaaag
caaggtgatctcatccggtatatagttcttcattttggcagatctctacaatatggaaat
cagttcatatatcagtcaatgccacgaatgttaactctatggcttgattatggtacaaag
gcatatgaatgggaaaaagctggccgctccgatcgtgtacaaatgaggaatgatttgggt
aaaataaacaaggttatcacagagcatacaaactatttagctccatatcaatttttgact
gctttttcacaattgatctctcgaatttgtcattctcacgatgaagtttttgttgtcttg
atggaaataatagccaaagtatttctagcctatcctcaacaagcaatgtggatgatgaca
gctgtgtcaaagtcatcttatcccatgcgtgtgaacagatgcaaggaaatcctcaataaa
gctattcatatgaaaaaatccttagagaagtttgttggagatgcaactcgcctaacagat
aagcttctagaattgtgcaataaaccggttgatggaagtagttccacattaagcatgagc
actcattttaaaatgcttaaaaagctggtagaagaagcaacatttagtgaaatcctcatt
cctctacaatcagtcatgatacctacacttccatcaattctgggtacccatgctaaccat
gctagccatgaaccatttcctggacattgggcctatattgcagggtttgatgatatggtg
gaaattcttgcttctcttcagaaaccaaagaagatttctttaaaaggctcagatggaaag
ttctacatcatgatgtgtaagccaaaagatgacctgagaaaggattgtagactaatggaa
ttcaattccttgattaataagtgcttaagaaaagatgcagagtctcgtagaagagaactt
catattcgaacatatgcagttattccactaaatgatgaatgtgggattattgaatgggtg
aacaacactgctggtttgagacctattctgaccaaactatataaagaaaagggagtgtat
atgacaggaaaagaacttcgccagtgtatgctaccaaagtcagcagctttatctgaaaaa
ctcaaagtattccgagaatttctcctgcccaggcatcctcctatttttcatgagtggttt
ctgagaacattccctgatcctacatcatggtacagtagtagatcagcttactgccgttcc
actgcagtaatgtcaatggttggttatattctggggcttggagaccgtcatggtgaaaat
attctctttgattctttgactggtgaatgcgtacatgtagatttcaattgtcttttcaat
aagggagaaacctttgaagttccagaaattgtgccatttcgcctgactcataatatggtt
aatggaatgggtcctatgggaacagagggtctttttcgaagagcatgtgaagttacaatg
aggctgatgcgtgatcagcgagagcctttaatgagtgtcttaaagacttttctacatgat
cctcttgtggaatggagtaaaccagtgaaagggcattccaaagcgccactgaatgaaact
ggagaagttgtcaatgaaaaggccaagacccatgttcttgacattgagcagcgactacaa
ggtgtaatcaagactcgaaatagagtgacaggactgccgttatctattgaaggacatgtg
cattaccttatacaggaagctactgatgaaaacttactatgccagatgtatcttggttgg
actccatatatgtga

DBGET integrated database retrieval system