KEGG   Homo sapiens (human): 5140Help
Entry
5140              CDS       T01001                                 

Gene name
PDE3B, HcGIP1, cGIPDE1
Definition
(RefSeq) phosphodiesterase 3B
  KO
K13296  cGMP-inhibited 3',5'-cyclic phosphodiesterase B [EC:3.1.4.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04371  Apelin signaling pathway
hsa04910  Insulin signaling pathway
hsa04914  Progesterone-mediated oocyte maturation
hsa04922  Glucagon signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429 D11630
Amrinone (DG00228): D00231 D02084
Anagrelide (DG00727): D02933 D07455 D10255
Bemoradan: D03075
Beradilol monoethyl maleate: D09843
Bucladesine (DG00230): D01238 D07546
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Cilostazol: D01896
Diprophylline: D00691
Enoximone: D04004
Enprofylline: D04006
Flavoxate (DG00477): D00718 D07961
Ibudilast: D01385
Imazodan hydrochloride: D04508
Indolidan: D04529
Isomazole hydrochloride: D04628
Levosimendan: D04720
Lixazinone sulfate: D04751
Milrinone (DG00229): D00417 D02085
Moxaverine (DG00045): D07089 D08238
Olprinone (DG01396): D02042 D08294
Oxagrelate: D05278
Papaverine (DG00043): D02218 D07425 D07439
Pimobendan: D01133
Piroximone: D05514
Prinoxodan: D05612
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Toborinone: D01198
Trapidil: D01220
Vesnarinone: D01690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5140 (PDE3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5140 (PDE3B)
   04024 cAMP signaling pathway
    5140 (PDE3B)
   04022 cGMP-PKG signaling pathway
    5140 (PDE3B)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    5140 (PDE3B)
   04922 Glucagon signaling pathway
    5140 (PDE3B)
   04923 Regulation of lipolysis in adipocytes
    5140 (PDE3B)
   04914 Progesterone-mediated oocyte maturation
    5140 (PDE3B)
   04924 Renin secretion
    5140 (PDE3B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5140 (PDE3B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     5140 (PDE3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I DUF1129
Motif
Other DBs
NCBI-GeneID: 5140
NCBI-ProteinID: NP_000913
OMIM: 602047
HGNC: 8779
Ensembl: ENSG00000152270
Vega: OTTHUMG00000165898
Pharos: Q13370(Tclin)
UniProt: Q13370 A7E2E5
LinkDB All DBs
Structure
PDB: 

Position
11p15.2
AA seq 1112 aa AA seqDB search
MRRDERDAKAMRSLQPPDGAGSPPESLRNGYVKSCVSPLRQDPPRGFFFHLCRFCNVELR
PPPASPQQPRRCSPFCRARLSLGALAAFVLALLLGAEPESWAAGAAWLRTLLSVCSHSLS
PLFSIACAFFFLTCFLTRTKRGPGPGRSCGSWWLLALPACCYLGDFLVWQWWSWPWGDGD
AGSAAPHTPPEAAAGRLLLVLSCVGLLLTLAHPLRLRHCVLVLLLASFVWWVSFTSLGSL
PSALRPLLSGLVGGAGCLLALGLDHFFQIREAPLHPRLSSAAEEKVPVIRPRRRSSCVSL
GETAASYYGSCKIFRRPSLPCISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEAR
NMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKG
DRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGP
FNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDT
ADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSG
KSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLD
LILVEEYDSLIEKMSNWNFPIFELVEKMGEKSGRILSQVMYTLFQDTGLLEIFKIPTQQF
MNYFRALENGYRDIPYHNRIHATDVLHAVWYLTTRPVPGLQQIHNGCGTGNETDSDGRIN
HGRIAYISSKSCSNPDESYGCLSSNIPALELMALYVAAAMHDYDHPGRTNAFLVATNAPQ
AVLYNDRSVLENHHAASAWNLYLSRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFD
FLAEFNAKANDVNSNGIEWSNENDRLLVCQVCIKLADINGPAKVRDLHLKWTEGIVNEFY
EQGDEEANLGLPISPFMDRSSPQLAKLQESFITHIVGPLCNSYDAAGLLPGQWLEAEEDN
DTESGDDEDGEELDTEDEEMENNLNPKPPRRKSRRRIFCQLMHHLTENHKIWKEIVEEEE
KCKADGNKLQVENSSLPQADEIQVIEEADEEE
NT seq 3339 nt NT seq  +upstreamnt  +downstreamnt
atgaggagggacgagcgagacgccaaagccatgcggtccctgcagccgccggatggggcc
ggctcgccccccgagagtctgaggaacggctacgtgaagagctgcgtgagccccttgcgg
caggaccctccgcgcggcttcttcttccacctctgccgcttctgcaacgtggagctgcgg
ccgccgccggcctctccccagcagccgcggcgctgctcccccttctgccgggcgcgcctc
tcgctgggcgccctggctgcctttgtcctcgccctgctgctgggcgcggaacccgagagc
tgggctgccggggccgcctggctgcggacgctgctgagcgtgtgttcgcacagcttgagc
cccctcttcagcatcgcctgtgccttcttcttcctcacctgcttcctcacccggaccaag
cggggacccggcccgggccggagctgcggctcctggtggctgctggcgctgcccgcctgc
tgttacctgggggacttcttggtgtggcagtggtggtcttggccttggggggatggcgac
gcagggtccgcggccccgcacacgcccccggaggcggcagcgggcaggttgctgctggtg
ctgagctgcgtagggctgctgctgacgctcgcgcacccgctgcggctccggcactgcgtt
ctggtgctgctcctggccagcttcgtctggtgggtctccttcaccagcctcgggtcgctg
ccctccgccctcaggccgctgctctccggcctggtggggggcgctggctgcctgctggcc
ctggggttggatcacttctttcaaatcagggaagcgcctcttcatcctcgactgtccagt
gccgccgaagaaaaagtgcctgtgatccgaccccggaggaggtccagctgcgtgtcgtta
ggagaaactgcagccagttactatggcagttgcaaaatattcaggagaccgtcgttgcct
tgtatttccagagaacagatgattctttgggattgggacttaaaacaatggtataagcct
cattatcaaaattctggaggtggaaatggagttgatctttcagtgctaaatgaggctcgc
aatatggtgtcagatcttctgactgatccaagccttccaccacaagtcatttcctctcta
cggagtattagtagcttaatgggtgctttctcaggttcctgtaggccaaagattaatcct
ctcacaccatttcctggattttacccctgttctgaaatagaggacccagctgagaaaggg
gatagaaaacttaacaagggactaaataggaatagtttgccaactccacagctgaggaga
agctcaggaacttcaggattgctacctgttgaacagtcttcaaggtgggatcgtaataat
ggcaaaagacctcaccaagaatttggcatttcaagtcaaggatgctatctaaatgggcct
tttaattcaaatctactgactatcccgaagcaaaggtcatcttctgtatcactgactcac
catgtaggtctcagaagagctggtgttttgtccagtctgagtcctgtgaattcttccaac
catggaccagtgtctactggctctctaactaatcgatcacccatagaatttcctgatact
gctgattttcttaataagccaagcgttatcttgcagagatctctgggcaatgcacctaat
actccagatttttatcagcaacttagaaattctgatagcaatctgtgtaacagctgtgga
catcaaatgctgaaatatgtttcaacatctgaatcagatggtacagattgctgcagtgga
aaatcaggtgaagaagaaaacattttctcgaaagaatcattcaaacttatggaaactcaa
caagaagaggaaacagagaagaaagacagcagaaaattatttcaggaaggtgataagtgg
ctaacagaagaggcacagagtgaacagcaaacaaatattgaacaggaagtatcactggac
ctgattttagtagaagagtatgactcattaatagaaaagatgagcaactggaattttcca
atttttgaacttgtagaaaagatgggagagaaatcaggaaggattctcagtcaggttatg
tataccttatttcaagacactggtttattggaaatatttaaaattcccactcaacaattt
atgaactattttcgtgcattagaaaatggctatcgagacattccttatcacaatcgtata
catgccacagatgtgctacatgcagtttggtatctgacaacacggccagttcctggctta
cagcagatccacaatggttgtggaacaggaaatgaaacagattctgatggtagaattaac
catgggcgaattgcttatatttcttcgaagagctgctctaatcctgatgagagttatggc
tgcctgtcttcaaacattcctgcattagaattgatggctctatacgtggcagctgccatg
catgattatgatcacccagggaggacaaatgcatttctagtggctacaaatgcccctcag
gcagttttatacaatgacagatctgttctggaaaatcatcatgctgcgtcagcttggaat
ctatatctttctcgcccagaatacaacttccttcttcatcttgatcatgtggaattcaag
cgctttcgttttttagtcattgaagcaatccttgctacggatcttaaaaagcattttgat
tttctcgcagaattcaatgccaaggcaaatgatgtaaatagtaatggcatagaatggagt
aatgaaaatgatcgcctcttggtatgccaggtgtgcatcaaactggcagatataaatggc
ccagcaaaagttcgagacttgcatttgaaatggacagaaggcattgtcaatgaattttat
gagcagggagatgaagaagcaaatcttggtctgcccatcagtccattcatggatcgttct
tctcctcaactagcaaaactccaagaatcttttatcacccacatagtgggtcccctgtgt
aactcctatgatgctgctggtttgctaccaggtcagtggttagaagcagaagaggataat
gatactgaaagtggtgatgatgaagacggtgaagaattagatacagaagatgaagaaatg
gaaaacaatctaaatccaaaaccaccaagaaggaaaagcagacggcgaatattttgtcag
ctaatgcaccacctcactgaaaaccacaagatatggaaggaaatcgtagaggaagaagaa
aaatgtaaagctgatgggaataaactgcaggtggagaattcctccttacctcaagcagat
gagattcaggtaattgaagaggcagatgaagaggaatag

DBGET integrated database retrieval system