KEGG   Homo sapiens (human): 6773Help
Entry
6773              CDS       T01001                                 

Gene name
STAT2, IMD44, ISGF-3, P113, STAT113
Definition
(RefSeq) signal transducer and activator of transcription 2
  KO
K11221  signal transducer and activator of transcription 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06122  IFN signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06219  JAK-STAT signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00150  Type I IFN signaling pathway
N00261  KSHV vIRF2 to IFN signaling pathway
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00471  EBV LMP2A/2B to IFN signaling pathway
N00472  EBV LMP1 to IFN signaling pathway
N00473  EBV BGLF4 to IFN signaling pathway
N00558  HBV pol to IFN signaling pathway
N00575  HSV ICP27 to IFN signaling pathway
N00576  HSV UL41/UL13 to IFN signaling pathway
N00577  HSV UL41 to IFN signaling pathway
N00578  HSV UL41 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    6773 (STAT2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    6773 (STAT2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6773 (STAT2)
   04625 C-type lectin receptor signaling pathway
    6773 (STAT2)
   04062 Chemokine signaling pathway
    6773 (STAT2)
  09158 Development
   04380 Osteoclast differentiation
    6773 (STAT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6773 (STAT2)
  09172 Infectious disease: viral
   05162 Measles
    6773 (STAT2)
   05164 Influenza A
    6773 (STAT2)
   05161 Hepatitis B
    6773 (STAT2)
   05160 Hepatitis C
    6773 (STAT2)
   05168 Herpes simplex virus 1 infection
    6773 (STAT2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6773 (STAT2)
   05169 Epstein-Barr virus infection
    6773 (STAT2)
   05165 Human papillomavirus infection
    6773 (STAT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    6773 (STAT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   STAT
    6773 (STAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STAT_alpha STAT2_C STAT_int STAT_bind SH2 CorA
Motif
Other DBs
NCBI-GeneID: 6773
NCBI-ProteinID: NP_005410
OMIM: 600556
HGNC: 11363
Ensembl: ENSG00000170581
Vega: OTTHUMG00000170760
Pharos: P52630(Tbio)
UniProt: P52630 R9QE65
LinkDB All DBs
Structure
PDB: 

Position
12q13.3
AA seq 851 aa AA seqDB search
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALGSDDSKATMLF
FHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQDPTQLAEMIFNLLLEEKRILI
QAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQ
AKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKA
QQQKACIRAPIDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRLQEGNESLTVE
VSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDFGYLTLVEQRSGGSGKGSNKG
PLGVTEELHIISFTVKYTYQGLKQELKTDTLPVVIISNMNQLSIAWASVLWFNLLSPNLQ
NQQFFSNPPKAPWSLLGPALSWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWAD
FTKRESPPGKLPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQLLTEENIPENP
LRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSNRQVDELQQPLELKPEPELES
LELELGLVPEPELSLDLEPLLKAGLDLGPELESVLESTLEPVIEPTLCMVSQTVPEPDQG
PVSQPVPEPDLPCDLRHLNTEPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHF
YTDGPLMPSDF
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagtgggaaatgctgcagaatcttgacagcccctttcaggatcagctgcaccag
ctttactcgcacagcctcctgcctgtggacattcgacagtacttggctgtctggattgaa
gaccagaactggcaggaagctgcacttgggagtgatgattccaaggctaccatgctattc
ttccacttcttggatcagctgaactatgagtgtggccgttgcagccaggacccagagtcc
ttgttgctgcagcacaatttgcggaaattctgccgggacattcagcccttttcccaggat
cctacccagttggctgagatgatctttaacctccttctggaagaaaaaagaattttgatc
caggctcagagggcccaattggaacaaggagagccagttctcgaaacacctgtggagagc
cagcaacatgagattgaatcccggatcctggatttaagggctatgatggagaagctggta
aaatccatcagccaactgaaagaccagcaggatgtcttctgcttccgatataagatccag
gccaaagggaagacaccctctctggacccccatcagaccaaagagcagaagattctgcag
gaaactctcaatgaactggacaaaaggagaaaggaggtgctggatgcctccaaagcactg
ctaggccgattaactaccctaatcgagctactgctgccaaagttggaggagtggaaggcc
cagcagcaaaaagcctgcatcagagctcccattgaccacgggttggaacagctggagaca
tggttcacagctggagcaaagctgttgtttcacctgaggcagctgctgaaggagctgaag
ggactgagttgcctggttagctatcaggatgaccctctgaccaaaggggtggacctacgc
aacgcccaggtcacagagttgctacagcgtctgctccacagagcctttgtggtagaaacc
cagccctgcatgccccaaactccccatcgacccctcatcctcaagactggcagcaagttc
accgtccgaacaaggctgctggtgagactccaggaaggcaatgagtcactgactgtggaa
gtctccattgacaggaatcctcctcaattacaaggcttccggaagttcaacattctgact
tcaaaccagaaaactttgacccccgagaaggggcagagtcagggtttgatttgggacttt
ggttacctgactctggtggagcaacgttcaggtggttcaggaaagggcagcaataagggg
ccactaggtgtgacagaggaactgcacatcatcagcttcacggtcaaatatacctaccag
ggtctgaagcaggagctgaaaacggacaccctccctgtggtgattatttccaacatgaac
cagctctcaattgcctgggcttcagttctctggttcaatttgctcagcccaaaccttcag
aaccagcagttcttctccaacccccccaaggccccctggagcttgctgggccctgctctc
agttggcagttctcctcctatgttggccgaggcctcaactcagaccagctgagcatgctg
agaaacaagctgttcgggcagaactgtaggactgaggatccattattgtcctgggctgac
ttcactaagcgagagagccctcctggcaagttaccattctggacatggctggacaaaatt
ctggagttggtacatgaccacctgaaggatctctggaatgatggacgcatcatgggcttt
gtgagtcggagccaggagcgccggctgctgaagaagaccatgtctggcacctttctactg
cgcttcagtgaatcgtcagaagggggcattacctgctcctgggtggagcaccaggatgat
gacaaggtgctcatctactctgtgcaaccgtacacgaaggaggtgctgcagtcactcccg
ctgactgaaatcatccgccattaccagttgctcactgaggagaatatacctgaaaaccca
ctgcgcttcctctatccccgaatcccccgggatgaagcttttgggtgctactaccaggag
aaagttaatctccaggaacggaggaaatacctgaaacacaggctcattgtggtctctaat
agacaggtggatgaactgcaacaaccgctggagcttaagccagagccagagctggagtca
ttagagctggaactagggctggtgccagagccagagctcagcctggacttagagccactg
ctgaaggcagggctggatctggggccagagctagagtctgtgctggagtccactctggag
cctgtgatagagcccacactatgcatggtatcacaaacagtgccagagccagaccaagga
cctgtatcacagccagtgccagagccagatttgccctgtgatctgagacatttgaacact
gagccaatggaaatcttcagaaactgtgtaaagattgaagaaatcatgccgaatggtgac
ccactgttggctggccagaacaccgtggatgaggtttacgtctcccgccccagccacttc
tacactgatggacccttgatgccttctgacttctag

DBGET integrated database retrieval system