KEGG   Homo sapiens (human): 8878
Entry
8878              CDS       T01001                                 

Gene name
SQSTM1, A170, DMRV, FTDALS3, NADGP, OSIL, PDB3, ZIP3, p60, p62, p62B
Definition
(RefSeq) sequestosome 1
  KO
K14381  sequestosome 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06421  Mitophagy
nt06464  Amyotrophic lateral sclerosis
  Element
N01137  PINK-Parkin-mediated autophagosome formation
N01139  Mutation-inactivated p62 to PINK-Parkin-mediated autophagosome formation
N01140  TBK1-mediated autophagosome formation
N01141  Mutation-inactivated TBK1 to TBK1-mediated autophagosome formation
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00437  Paget disease of bone
H02342  Frontotemporal dementia and amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    8878 (SQSTM1)
   04137 Mitophagy - animal
    8878 (SQSTM1)
  09143 Cell growth and death
   04217 Necroptosis
    8878 (SQSTM1)
   04218 Cellular senescence
    8878 (SQSTM1)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    8878 (SQSTM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    8878 (SQSTM1)
   05022 Pathways of neurodegeneration - multiple diseases
    8878 (SQSTM1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    8878 (SQSTM1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8878 (SQSTM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8878 (SQSTM1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8878 (SQSTM1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8878 (SQSTM1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Cargo receptors
    8878 (SQSTM1)
  Pexophagy
    8878 (SQSTM1)
  Aggrephagy
    8878 (SQSTM1)
  Xenophagy
    8878 (SQSTM1)
  Other autophagy associated proteins
   Midbophagy associated proteins
    8878 (SQSTM1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    8878 (SQSTM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   8878 (SQSTM1)
SSDB
Motif
Pfam: UBA_5 ZZ PB1 C1_2
Other DBs
NCBI-GeneID: 8878
NCBI-ProteinID: NP_003891
OMIM: 601530
HGNC: 11280
Ensembl: ENSG00000161011
Vega: OTTHUMG00000150643
Pharos: Q13501(Tbio)
UniProt: Q13501
LinkDB
Structure
PDB: 

Position
5q35.3
AA seq 440 aa
MASLTVKAYLLGKEDAAREIRRFSFCCSPEPEAEAEAAAGPGPCERLLSRVAALFPALRP
GGFQAHYRDEDGDLVAFSSDEELTMAMSYVKDDIFRIYIKEKKECRRDHRPPCAQEAPRN
MVHPNVICDGCNGPVVGTRYKCSVCPDYDLCSVCEGKGLHRGHTKLAFPSPFGHLSEGFS
HSRWLRKVKHGHFGWPGWEMGPPGNWSPRPPRAGEARPGPTAESASGPSEDPSVNFLKNV
GESVAAALSPLGIEVDIDVEHGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNV
EGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSKEVDPSTGELQSLQMPE
SEGPSSLDPSQEGPTGLKEAALYPHLPPEADPRLIESLSQMLSMGFSDEGGWLTRLLQTK
NYDIGAALDTIQYSKHPPPL
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggcgtcgctcaccgtgaaggcctaccttctgggcaaggaggacgcggcgcgcgagatt
cgccgcttcagcttctgctgcagccccgagcctgaggcggaagccgaggctgcggcgggt
ccgggaccctgcgagcggctgctgagccgggtggccgccctgttccccgcgctgcggcct
ggcggcttccaggcgcactaccgcgatgaggacggggacttggttgccttttccagtgac
gaggaattgacaatggccatgtcctacgtgaaggatgacatcttccgaatctacattaaa
gagaaaaaagagtgccggcgggaccaccgcccaccgtgtgctcaggaggcgccccgcaac
atggtgcaccccaatgtgatctgcgatggctgcaatgggcctgtggtaggaacccgctac
aagtgcagcgtctgcccagactacgacttgtgtagcgtctgcgagggaaagggcttgcac
cgggggcacaccaagctcgcattccccagccccttcgggcacctgtctgagggcttctcg
cacagccgctggctccggaaggtgaaacacggacacttcgggtggccaggatgggaaatg
ggtccaccaggaaactggagcccacgtcctcctcgtgcaggggaggcccgccctggcccc
acggcagaatcagcttctggtccatcggaggatccgagtgtgaatttcctgaagaacgtt
ggggagagtgtggcagctgcccttagccctctgggcattgaagttgatatcgatgtggag
cacggagggaaaagaagccgcctgacccccgtctctccagagagttccagcacagaggag
aagagcagctcacagccaagcagctgctgctctgaccccagcaagccgggtgggaatgtt
gagggcgccacgcagtctctggcggagcagatgaggaagatcgccttggagtccgagggg
cgccctgaggaacagatggagtcggataactgttcaggaggagatgatgactggacccat
ctgtcttcaaaagaagtggacccgtctacaggtgaactccagtccctacagatgccagaa
tccgaagggccaagctctctggacccctcccaggagggacccacagggctgaaggaagct
gccttgtacccacatctcccgccagaggctgacccgcggctgattgagtccctctcccag
atgctgtccatgggcttctctgatgaaggcggctggctcaccaggctcctgcagaccaag
aactatgacatcggagcggctctggacaccatccagtattcaaagcatcccccgccgttg
tga

DBGET integrated database retrieval system