KEGG   Homo sapiens (human): 332
Entry
332               CDS       T01001                                 
Symbol
BIRC5, API4, EPR-1
Name
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04390  Hippo signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06214  PI3K signaling
nt06215  WNT signaling
nt06230  Cell cycle
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06271  Endometrial cancer
  Element
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00533  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
N01339  NNK/NNN to PI3K signaling pathway
Drug target
Gataparsen (DG01431): D09909 D09910
Sepantronium bromide: D10164
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    332 (BIRC5)
   04215 Apoptosis - multiple species
    332 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    332 (BIRC5)
   05207 Chemical carcinogenesis - receptor activation
    332 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    332 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    332 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    332 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    332 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    332 (BIRC5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   332 (BIRC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     332 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 332
NCBI-ProteinID: NP_001159
OMIM: 603352
HGNC: 593
Ensembl: ENSG00000089685
Pharos: O15392(Tchem)
UniProt: O15392 A0A0B4J1S3
Structure
LinkDB
Position
17:78214253..78225635
AA seq 142 aa
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtccggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttttgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgcc
atggattga

KEGG   Homo sapiens (human): 331
Entry
331               CDS       T01001                                 
Symbol
XIAP, API3, BIRC4, IAP-3, ILP1, MIHA, XLP2, hIAP-3, hIAP3
Name
(RefSeq) X-linked inhibitor of apoptosis
  KO
K04725  E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa05145  Toxoplasmosis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05222  Small cell lung cancer
Network
nt06230  Cell cycle
  Element
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
Disease
H00107  Other well-defined immunodeficiency syndromes
H01969  X-linked lymphoproliferative syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    331 (XIAP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    331 (XIAP)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    331 (XIAP)
   04215 Apoptosis - multiple species
    331 (XIAP)
   04217 Necroptosis
    331 (XIAP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    331 (XIAP)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    331 (XIAP)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    331 (XIAP)
   05207 Chemical carcinogenesis - receptor activation
    331 (XIAP)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    331 (XIAP)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    331 (XIAP)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    331 (XIAP)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    331 (XIAP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    331 (XIAP)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    331 (XIAP)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    331 (XIAP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     331 (XIAP)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   331 (XIAP)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    331 (XIAP)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    331 (XIAP)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_UBOX DUF2039
Other DBs
NCBI-GeneID: 331
NCBI-ProteinID: NP_001158
OMIM: 300079
HGNC: 592
Ensembl: ENSG00000101966
Pharos: P98170(Tchem)
UniProt: P98170
Structure
LinkDB
Position
X:123859708..123913972
AA seq 497 aa
MTFNSFEGSKTCVPADINKEEEFVEEFNRLKTFANFPSGSPVSASTLARAGFLYTGEGDT
VRCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYLENSATQSTNSGIQNGQYKVENY
LGSRDHFALDRPSETHADYLLRTGQVVDISDTIYPRNPAMYSEEARLKSFQNWPDYAHLT
PRELASAGLYYTGIGDQVQCFCCGGKLKNWEPCDRAWSEHRRHFPNCFFVLGRNLNIRSE
SDAVSSDRNFPNSTNLPRNPSMADYEARIFTFGTWIYSVNKEQLARAGFYALGEGDKVKC
FHCGGGLTDWKPSEDPWEQHAKWYPGCKYLLEQKGQEYINNIHLTHSLEECLVRTTEKTP
SLTRRIDDTIFQNPMVQEAIRMGFSFKDIKKIMEEKIQISGSNYKSLEVLVADLVNAQKD
SMQDESSQTSLQKEISTEEQLRRLQEEKLCKICMDRNIAIVFVPCGHLVTCKQCAEAVDK
CPMCYTVITFKQKIFMS
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgacttttaacagttttgaaggatctaaaacttgtgtacctgcagacatcaataaggaa
gaagaatttgtagaagagtttaatagattaaaaacttttgctaattttccaagtggtagt
cctgtttcagcatcaacactggcacgagcagggtttctttatactggtgaaggagatacc
gtgcggtgctttagttgtcatgcagctgtagatagatggcaatatggagactcagcagtt
ggaagacacaggaaagtatccccaaattgcagatttatcaacggcttttatcttgaaaat
agtgccacgcagtctacaaattctggtatccagaatggtcagtacaaagttgaaaactat
ctgggaagcagagatcattttgccttagacaggccatctgagacacatgcagactatctt
ttgagaactgggcaggttgtagatatatcagacaccatatacccgaggaaccctgccatg
tatagtgaagaagctagattaaagtcctttcagaactggccagactatgctcacctaacc
ccaagagagttagcaagtgctggactctactacacaggtattggtgaccaagtgcagtgc
ttttgttgtggtggaaaactgaaaaattgggaaccttgtgatcgtgcctggtcagaacac
aggcgacactttcctaattgcttctttgttttgggccggaatcttaatattcgaagtgaa
tctgatgctgtgagttctgataggaatttcccaaattcaacaaatcttccaagaaatcca
tccatggcagattatgaagcacggatctttacttttgggacatggatatactcagttaac
aaggagcagcttgcaagagctggattttatgctttaggtgaaggtgataaagtaaagtgc
tttcactgtggaggagggctaactgattggaagcccagtgaagacccttgggaacaacat
gctaaatggtatccagggtgcaaatatctgttagaacagaagggacaagaatatataaac
aatattcatttaactcattcacttgaggagtgtctggtaagaactactgagaaaacacca
tcactaactagaagaattgatgataccatcttccaaaatcctatggtacaagaagctata
cgaatggggttcagtttcaaggacattaagaaaataatggaggaaaaaattcagatatct
gggagcaactataaatcacttgaggttctggttgcagatctagtgaatgctcagaaagac
agtatgcaagatgagtcaagtcagacttcattacagaaagagattagtactgaagagcag
ctaaggcgcctgcaagaggagaagctttgcaaaatctgtatggatagaaatattgctatc
gtttttgttccttgtggacatctagtcacttgtaaacaatgtgctgaagcagttgacaag
tgtcccatgtgctacacagtcattactttcaagcaaaaaatttttatgtcttaa

KEGG   Homo sapiens (human): 990
Entry
990               CDS       T01001                                 
Symbol
CDC6, CDC18L, HsCDC18, HsCDC6, MGORS5
Name
(RefSeq) cell division cycle 6
  KO
K02213  cell division control protein 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06230  Cell cycle
  Element
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    990 (CDC6)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    990 (CDC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    990 (CDC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    990 (CDC6)
SSDB
Motif
Pfam: Cdc6_C AAA_22 AAA AAA_16 AAA_lid_10 NACHT AAA_19 NB-ARC AAA_30 DUF2075 DUF815 AAA_7 NTPase_1 T2SSE Pox_A32 Zot ResIII AAA_5 ORC5_C Helicase_RecD RNA_helicase
Other DBs
NCBI-GeneID: 990
NCBI-ProteinID: NP_001245
OMIM: 602627
HGNC: 1744
Ensembl: ENSG00000094804
Pharos: Q99741(Tbio)
UniProt: Q99741 A0A024R1S2
Structure
LinkDB
Position
17:40287879..40304657
AA seq 560 aa
MPQTRSQAQATISFPKRKLSRALNKAKNSSDAKLEPTNVQTVTCSPRVKALPLSPRKRLG
DDNLCNTPHLPPCSPPKQGKKENGPPHSHTLKGRRLVFDNQLTIKSPSKRELAKVHQNKI
LSSVRKSQEITTNSEQRCPLKKESACVRLFKQEGTCYQQAKLVLNTAVPDRLPAREREMD
VIRNFLREHICGKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQ
AVFPAIAQEICQEEVSRPAGKDMMRKLEKHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTL
FEWPWLSNSHLVLIGIANTLDLTDRILPRLQAREKCKPQLLNFPPYTRNQIVTILQDRLN
QVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSP
SEPLIPKRVGLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSLMLLIRQLKIKEV
TLGKLYEAYSKVCRKQQVAAVDQSECLSLSGLLEARGILGLKRNKETRLTKVFFKIEEKE
IEHALKDKALIGNILATGLP
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcctcaaacccgatcccaggcacaggctacaatcagttttccaaaaaggaagctgtct
cgggcattgaacaaagctaaaaactccagtgatgccaaactagaaccaacaaatgtccaa
accgtaacctgttctcctcgtgtaaaagccctgcctctcagccccaggaaacgtctgggc
gatgacaacctatgcaacactccccatttacctccttgttctccaccaaagcaaggcaag
aaagagaatggtccccctcactcacatacacttaagggacgaagattggtatttgacaat
cagctgacaattaagtctcctagcaaaagagaactagccaaagttcaccaaaacaaaata
ctttcttcagttagaaaaagtcaagagatcacaacaaattctgagcagagatgtccactg
aagaaagaatctgcatgtgtgagactattcaagcaagaaggcacttgctaccagcaagca
aagctggtcctgaacacagctgtcccagatcggctgcctgccagggaaagggagatggat
gtcatcaggaatttcttgagggaacacatctgtgggaaaaaagctggaagcctttacctt
tctggtgctcctggaactggaaaaactgcctgcttaagccggattctgcaagacctcaag
aaggaactgaaaggctttaaaactatcatgctgaattgcatgtccttgaggactgcccag
gctgtattcccagctattgctcaggagatttgtcaggaagaggtatccaggccagctggg
aaggacatgatgaggaaattggaaaaacatatgactgcagagaagggccccatgattgtg
ttggtattggacgagatggatcaactggacagcaaaggccaggatgtattgtacacgcta
tttgaatggccatggctaagcaattctcacttggtgctgattggtattgctaataccctg
gatctcacagatagaattctacctaggcttcaagctagagaaaaatgtaagccacagctg
ttgaacttcccaccttataccagaaatcagatagtcactattttgcaagatcgacttaat
caggtatctagagatcaggttctggacaatgctgcagttcaattctgtgcccgcaaagtc
tctgctgtttcaggagatgttcgcaaagcactggatgtttgcaggagagctattgaaatt
gtagagtcagatgtcaaaagccagactattctcaaaccactgtctgaatgtaaatcacct
tctgagcctctgattcccaagagggttggtcttattcacatatcccaagtcatctcagaa
gttgatggtaacaggatgaccttgagccaagaaggagcacaagattccttccctcttcag
cagaagatcttggtttgctctttgatgctcttgatcaggcagttgaaaatcaaagaggtc
actctggggaagttatatgaagcctacagtaaagtctgtcgcaaacagcaggtggcggct
gtggaccagtcagagtgtttgtcactttcagggctcttggaagccaggggcattttagga
ttaaagagaaacaaggaaacccgtttgacaaaggtgtttttcaagattgaagagaaagaa
atagaacatgctctgaaagataaagctttaattggaaatatcttagctactggattgcct
taa

KEGG   Homo sapiens (human): 993
Entry
993               CDS       T01001                                 
Symbol
CDC25A, CDC25A2
Name
(RefSeq) cell division cycle 25A
  KO
K06645  M-phase inducer phosphatase 1 [EC:3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04218  Cellular senescence
hsa04914  Progesterone-mediated oocyte maturation
hsa05206  MicroRNAs in cancer
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06230  Cell cycle
  Element
N01337  NNK/NNN to CHRNA7-E2F signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    993 (CDC25A)
   04218 Cellular senescence
    993 (CDC25A)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    993 (CDC25A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    993 (CDC25A)
   05207 Chemical carcinogenesis - receptor activation
    993 (CDC25A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    993 (CDC25A)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    993 (CDC25A)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    993 (CDC25A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     993 (CDC25A)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    993 (CDC25A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     993 (CDC25A)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    993 (CDC25A)
SSDB
Motif
Pfam: M-inducer_phosp Rhodanese
Other DBs
NCBI-GeneID: 993
NCBI-ProteinID: NP_001780
OMIM: 116947
HGNC: 1725
Ensembl: ENSG00000164045
Pharos: P30304(Tchem)
UniProt: P30304
Structure
LinkDB
Position
3:complement(48157146..48188417)
AA seq 524 aa
MELGPEPPHRRRLLFACSPPPASQPVVKALFGASAAGGLSPVTNLTVTMDQLQGLGSDYE
QPLEVKNNSNLQRMGSSESTDSGFCLDSPGPLDSKENLENPMRRIHSLPQKLLGCSPALK
RSHSDSLDHDIFQLIDPDENKENEAFEFKKPVRPVSRGCLHSHGLQEGKDLFTQRQNSAP
ARMLSSNERDSSEPGNFIPLFTPQSPVTATLSDEDDGFVDLLDGENLKNEEETPSCMASL
WTAPLVMRTTNLDNRCKLFDSPSLCSSSTRSVLKRPERSQEESPPGSTKRRKSMSGASPK
ESTNPEKAHETLHQSLSLASSPKGTIENILDNDPRDLIGDFSKGYLFHTVAGKHQDLKYI
SPEIMASVLNGKFANLIKEFVIIDCRYPYEYEGGHIKGAVNLHMEEEVEDFLLKKPIVPT
DGKRVIVVFHCEFSSERGPRMCRYVRERDRLGNEYPKLHYPELYVLKGGYKEFFMKCQSY
CEPPSYRPMHHEDFKEDLKKFRTKSRTWAGEKSKREMYSRLKKL
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggaactgggcccggagcccccgcaccgccgccgcctgctcttcgcctgcagcccccct
cccgcgtcgcagcccgtcgtgaaggcgctatttggcgcttcagccgccgggggactgtcg
cctgtcaccaacctgaccgtcactatggaccagctgcagggtctgggcagtgattatgag
caaccactggaggtgaagaacaacagtaatctgcagagaatgggctcctccgagtcaaca
gattcaggtttctgtctagattctcctgggccattggacagtaaagaaaaccttgaaaat
cctatgagaagaatacattccctacctcagaagctgttgggatgtagtccagctctgaag
aggagccattctgattctcttgaccatgacatctttcagctcatcgacccagatgagaac
aaggaaaatgaagcctttgagtttaagaagccagtaagacctgtatctcgtggctgcctg
cactctcatggactccaggagggtaaagatctcttcacacagaggcagaactctgcccca
gctcggatgctttcctcaaatgaaagagatagcagtgaaccagggaatttcattcctctt
tttacaccccagtcacctgtgacagccactttgtctgatgaggatgatggcttcgtggac
cttctcgatggagagaatctgaagaatgaggaggagaccccctcgtgcatggcaagcctc
tggacagctcctctcgtcatgagaactacaaaccttgacaaccgatgcaagctgtttgac
tccccttccctgtgtagctccagcactcggtcagtgttgaagagaccagaacgatctcaa
gaggagtctccacctggaagtacaaagaggaggaagagcatgtctggggccagccccaaa
gagtcaactaatccagagaaggcccatgagactcttcatcagtctttatccctggcatct
tcccccaaaggaaccattgagaacattttggacaatgacccaagggaccttataggagac
ttctccaagggttatctctttcatacagttgctgggaaacatcaggatttaaaatacatc
tctccagaaattatggcatctgttttgaatggcaagtttgccaacctcattaaagagttt
gttatcatcgactgtcgatacccatatgaatacgagggaggccacatcaagggtgcagtg
aacttgcacatggaagaagaggttgaagacttcttattgaagaagcccattgtacctact
gatggcaagcgtgtcattgttgtgtttcactgcgagttttcttctgagagaggtccccgc
atgtgccggtatgtgagagagagagatcgcctgggtaatgaataccccaaactccactac
cctgagctgtatgtcctgaaggggggatacaaggagttctttatgaaatgccagtcttac
tgtgagccccctagctaccggcccatgcaccacgaggactttaaagaagacctgaagaag
ttccgcaccaagagccggacctgggcaggggagaagagcaagagggagatgtacagtcgt
ctgaagaagctctga

DBGET integrated database retrieval system