KEGG   Homo sapiens (human): 5141
Entry
5141              CDS       T01001                                 
Symbol
PDE4A, DPDE2, PDE4, PDE46
Name
(RefSeq) phosphodiesterase 4A
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314<JP>
Diprophylline: D00691<JP>
Dipyridamole: D00302<JP/US>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5141 (PDE4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5141 (PDE4A)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5141 (PDE4A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5141 (PDE4A)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5141 (PDE4A)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR NadA Emfourin
Other DBs
NCBI-GeneID: 5141
NCBI-ProteinID: NP_001104777
OMIM: 600126
HGNC: 8780
Ensembl: ENSG00000065989
Vega: OTTHUMG00000180411
Pharos: P27815(Tclin)
UniProt: P27815
Structure
LinkDB
Position
19:10416773..10469631
AA seq 886 aa
MEPPTVPSERSLSLSLPGPREGQATLKPPPQHLWRQPRTPIRIQQRGYSDSAERAERERQ
PHRPIERADAMDTSDRPGLRTTRMSWPSSFHGTGTGSGGAGGGSSRRFEAENGPTPSPGR
SPLDSQASPGLVLHAGAATSQRRESFLYRSDSDYDMSPKTMSRNSSVTSEAHAEDLIVTP
FAQVLASLRSVRSNFSLLTNVPVPSNKRSPLGGPTPVCKATLSEETCQQLARETLEELDW
CLEQLETMQTYRSVSEMASHKFKRMLNRELTHLSEMSRSGNQVSEYISTTFLDKQNEVEI
PSPTMKEREKQQAPRPRPSQPPPPPVPHLQPMSQITGLKKLMHSNSLNNSNIPRFGVKTD
QEELLAQELENLNKWGLNIFCVSDYAGGRSLTCIMYMIFQERDLLKKFRIPVDTMVTYML
TLEDHYHADVAYHNSLHAADVLQSTHVLLATPALDAVFTDLEILAALFAAAIHDVDHPGV
SNQFLINTNSELALMYNDESVLENHHLAVGFKLLQEDNCDIFQNLSKRQRQSLRKMVIDM
VLATDMSKHMTLLADLKTMVETKKVTSSGVLLLDNYSDRIQVLRNMVHCADLSNPTKPLE
LYRQWTDRIMAEFFQQGDRERERGMEISPMCDKHTASVEKSQVGFIDYIVHPLWETWADL
VHPDAQEILDTLEDNRDWYYSAIRQSPSPPPEEESRGPGHPPLPDKFQFELTLEEEEEEE
ISMAQIPCTAQEALTAQGLSGVEEALDATIAWEASPAQESLEVMAQEASLEAELEAVYLT
QQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHAPGLPGLP
STAAEVEAQREHQAAKRACSACAGTFGEDTSALPAPGGGGSGGDPT
NT seq 2661 nt   +upstreamnt  +downstreamnt
atggaacccccgaccgtcccctcggaaaggagcctgtctctgtcactgcccgggccccgg
gagggccaggccaccctgaagcctcccccgcagcacctgtggcggcagcctcggaccccc
atccgtatccagcagcgcggctactccgacagcgcggagcgcgccgagcgggagcggcag
ccgcaccggcccatagagcgcgccgatgccatggacaccagcgaccggcccggcctgcgc
acgacccgcatgtcctggccctcgtccttccatggcactggcaccggcagcggcggcgcg
ggcggaggcagcagcaggcgcttcgaggcagagaatgggccgacaccatctcctggccgc
agccccctggactcgcaggcgagcccaggactcgtgctgcacgccggggcggccaccagc
cagcgccgggagtccttcctgtaccgctcagacagcgactatgacatgtcacccaagacc
atgtcccggaactcatcggtcaccagcgaggcgcacgctgaagacctcatcgtaacacca
tttgctcaggtgctggccagcctccggagcgtccgtagcaacttctcactcctgaccaat
gtgcccgttcccagtaacaagcggtccccgctgggcggccccacccctgtctgcaaggcc
acgctgtcagaagaaacgtgtcagcagttggcccgggagactctggaggagctggactgg
tgtctggagcagctggagaccatgcagacctatcgctctgtcagcgagatggcctcgcac
aagttcaaaaggatgttgaaccgtgagctcacacacctgtcagaaatgagcaggtccgga
aaccaggtctcagagtacatttccacaacattcctggacaaacagaatgaagtggagatc
ccatcacccacgatgaaggaacgagaaaaacagcaagcgccgcgaccaagaccctcccag
ccgcccccgccccctgtaccacacttacagcccatgtcccaaatcacagggttgaaaaag
ttgatgcatagtaacagcctgaacaactctaacattccccgatttggggtgaagaccgat
caagaagagctcctggcccaagaactggagaacctgaacaagtggggcctgaacatcttt
tgcgtgtcggattacgctggaggccgctcactcacctgcatcatgtacatgatattccag
gagcgggacctgctgaagaaattccgcatccctgtggacacgatggtgacatacatgctg
acgctggaggatcactaccacgctgacgtggcctaccataacagcctgcacgcagctgac
gtgctgcagtccacccacgtactgctggccacgcctgcactagatgcagtgttcacggac
ctggagattctcgccgccctcttcgcggctgccatccacgatgtggatcaccctggggtc
tccaaccagttcctcatcaacaccaattcggagctggcgctcatgtacaacgatgagtcg
gtgctcgagaatcaccacctggccgtgggcttcaagctgctgcaggaggacaactgcgac
atcttccagaacctcagcaagcgccagcggcagagcctacgcaagatggtcatcgacatg
gtgctggccacggacatgtccaagcacatgaccctcctggctgacctgaagaccatggtg
gagaccaagaaagtgaccagctcaggggtcctcctgctagataactactccgaccgcatc
caggtcctccggaacatggtgcactgtgccgacctcagcaaccccaccaagccgctggag
ctgtaccgccagtggacagaccgcatcatggccgagttcttccagcagggtgaccgagag
cgcgagcgtggcatggaaatcagccccatgtgtgacaagcacactgcctccgtggagaag
tctcaggtgggttttattgactacattgtgcacccattgtgggagacctgggcggacctt
gtccacccagatgcccaggagatcttggacactttggaggacaaccgggactggtactac
agcgccatccggcagagcccatctccgccacccgaggaggagtcaagggggccaggccac
ccacccctgcctgacaagttccagtttgagctgacgctggaggaggaagaggaggaagaa
atatcaatggcccagataccgtgcacagcccaagaggcattgactgcgcagggattgtca
ggagtcgaggaagctctggatgcaaccatagcctgggaggcatccccggcccaggagtcg
ttggaagttatggcacaggaagcatccctggaggccgagctggaggcagtgtatttgaca
cagcaggcacagtccacaggcagtgcacctgtggctccggatgagttctcgtcccgggag
gaattcgtggttgctgtaagccacagcagcccctctgccctggctcttcaaagccccctt
ctccctgcttggaggaccctgtctgtttcagagcatgccccgggcctcccgggcctcccc
tccacggcggccgaggtggaggcccaacgagagcaccaggctgccaagagggcttgcagt
gcctgcgcagggacatttggggaggacacatccgcactcccagctcctggtggcgggggg
tcaggtggagaccctacctga

KEGG   Homo sapiens (human): 5142
Entry
5142              CDS       T01001                                 
Symbol
PDE4B, DPDE4, PDEIVB
Name
(RefSeq) phosphodiesterase 4B
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314<JP>
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5142 (PDE4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5142 (PDE4B)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5142 (PDE4B)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5142 (PDE4B)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5142 (PDE4B)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 5142
NCBI-ProteinID: NP_001032418
OMIM: 600127
HGNC: 8781
Ensembl: ENSG00000184588
Vega: OTTHUMG00000009088
Pharos: Q07343(Tclin)
UniProt: Q07343 X5DNX5
Structure
LinkDB
Position
1:65792510..66374579
AA seq 736 aa
MKKSRSVMTVMADDNVKDYFECSLSKSYSSSSNTLGIDLWRGRRCCSGNLQLPPLSQRQS
ERARTPEGDGISRPTTLPLTTLPSIAITTVSQECFDVENGPSPGRSPLDPQASSSAGLVL
HATFPGHSQRRESFLYRSDSDYDLSPKAMSRNSSLPSEQHGDDLIVTPFAQVLASLRSVR
NNFTILTNLHGTSNKRSPAASQPPVSRVNPQEESYQKLAMETLEELDWCLDQLETIQTYR
SVSEMASNKFKRMLNRELTHLSEMSRSGNQVSEYISNTFLDKQNDVEIPSPTQKDREKKK
KQQLMTQISGVKKLMHSSSLNNTSISRFGVNTENEDHLAKELEDLNKWGLNIFNVAGYSH
NRPLTCIMYAIFQERDLLKTFRISSDTFITYMMTLEDHYHSDVAYHNSLHAADVAQSTHV
LLSTPALDAVFTDLEILAAIFAAAIHDVDHPGVSNQFLINTNSELALMYNDESVLENHHL
AVGFKLLQEEHCDIFMNLTKKQRQTLRKMVIDMVLATDMSKHMSLLADLKTMVETKKVTS
SGVLLLDNYTDRIQVLRNMVHCADLSNPTKSLELYRQWTDRIMEEFFQQGDKERERGMEI
SPMCDKHTASVEKSQVGFIDYIVHPLWETWADLVQPDAQDILDTLEDNRNWYQSMIPQSP
SPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLG
ETDIDIATEDKSPVDT
NT seq 2211 nt   +upstreamnt  +downstreamnt
atgaagaaaagcaggagtgtgatgacggtgatggctgatgataatgttaaagattatttt
gaatgtagcttgagtaaatcctacagttcttccagtaacacacttgggatcgacctctgg
agagggagaaggtgttgctcaggaaacttacagttaccaccactgtctcaaagacagagt
gaaagggcaaggactcctgagggagatggtatttccaggccgaccacactgcctttgaca
acgcttccaagcattgctattacaactgtaagccaggagtgctttgatgtggaaaatggc
ccttccccaggtcggagtccactggatccccaggccagctcttccgctgggctggtactt
cacgccacctttcctgggcacagccagcgcagagagtcatttctctacagatcagacagc
gactatgacttgtcaccaaaggcgatgtcgagaaactcttctcttccaagcgagcaacac
ggcgatgacttgattgtaactccttttgcccaggtccttgccagcttgcgaagtgtgaga
aacaacttcactatactgacaaaccttcatggtacatctaacaagaggtccccagctgct
agtcagcctcctgtctccagagtcaacccacaagaagaatcttatcaaaaattagcaatg
gaaacgctggaggaattagactggtgtttagaccagctagagaccatacagacctaccgg
tctgtcagtgagatggcttctaacaagttcaaaagaatgctgaaccgggagctgacacac
ctctcagagatgagccgatcagggaaccaggtgtctgaatacatttcaaatactttctta
gacaagcagaatgatgtggagatcccatctcctacccagaaagacagggagaaaaagaaa
aagcagcagctcatgacccagataagtggagtgaagaaattaatgcatagttcaagccta
aacaatacaagcatctcacgctttggagtcaacactgaaaatgaagatcacctggccaag
gagctggaagacctgaacaaatggggtcttaacatctttaatgtggctggatattctcac
aatagacccctaacatgcatcatgtatgctatattccaggaaagagacctcctaaagaca
ttcagaatctcatctgacacatttataacctacatgatgactttagaagaccattaccat
tctgacgtggcatatcacaacagcctgcacgctgctgatgtagcccagtcgacccatgtt
ctcctttctacaccagcattagacgctgtcttcacagatttggagatcctggctgccatt
tttgcagctgccatccatgacgttgatcatcctggagtctccaatcagtttctcatcaac
acaaattcagaacttgctttgatgtataatgatgaatctgtgttggaaaatcatcacctt
gctgtgggtttcaaactgctgcaagaagaacactgtgacatcttcatgaatctcaccaag
aagcagcgtcagacactcaggaagatggttattgacatggtgttagcaactgatatgtct
aaacatatgagcctgctggcagacctgaagacaatggtagaaacgaagaaagttacaagt
tcaggcgttcttctcctagacaactataccgatcgcattcaggtccttcgcaacatggta
cactgtgcagacctgagcaaccccaccaagtccttggaattgtatcggcaatggacagac
cgcatcatggaggaatttttccagcagggagacaaagagcgggagaggggaatggaaatt
agcccaatgtgtgataaacacacagcttctgtggaaaaatcccaggttggtttcatcgac
tacattgtccatccattgtgggagacatgggcagatttggtacagcctgatgctcaggac
attctcgataccttagaagataacaggaactggtatcagagcatgatacctcaaagtccc
tcaccaccactggacgagcagaacagggactgccagggtctgatggagaagtttcagttt
gaactgactctcgatgaggaagattctgaaggacctgagaaggagggagagggacacagc
tatttcagcagcacaaagacgctttgtgtgattgatccagaaaacagagattccctggga
gagactgacatagacattgcaacagaagacaagtcccccgtggatacataa

KEGG   Homo sapiens (human): 5143
Entry
5143              CDS       T01001                                 
Symbol
PDE4C, DPDE1, PDE21
Name
(RefSeq) phosphodiesterase 4C
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314<JP>
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5143 (PDE4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5143 (PDE4C)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5143 (PDE4C)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5143 (PDE4C)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5143 (PDE4C)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR Emfourin
Other DBs
NCBI-GeneID: 5143
NCBI-ProteinID: NP_000914
OMIM: 600128
HGNC: 8782
Ensembl: ENSG00000105650 ENSG00000285188
Vega: OTTHUMG00000183353
Pharos: Q08493(Tclin)
UniProt: Q08493 Q32MM7 O43849
Structure
LinkDB
Position
19:complement(18207965..18248433)
AA seq 712 aa
MENLGVGEGAEACSRLSRSRGRHSMTRAPKHLWRQPRRPIRIQQRFYSDPDKSAGCRERD
LSPRPELRKSRLSWPVSSCRRFDLENGLSCGRRALDPQSSPGLGRIMQAPVPHSQRRESF
LYRSDSDYELSPKAMSRNSSVASDLHGEDMIVTPFAQVLASLRTVRSNVAALARQQCLGA
AKQGPVGNPSSSNQLPPAEDTGQKLALETLDELDWCLDQLETLQTRHSVGEMASNKFKRI
LNRELTHLSETSRSGNQVSEYISRTFLDQQTEVELPKVTAEEAPQPMSRISGLHGLCHSA
SLSSATVPRFGVQTDQEEQLAKELEDTNKWGLDVFKVAELSGNRPLTAIIFSIFQERDLL
KTFQIPADTLATYLLMLEGHYHANVAYHNSLHAADVAQSTHVLLATPALEAVFTDLEILA
ALFASAIHDVDHPGVSNQFLINTNSELALMYNDASVLENHHLAVGFKLLQAENCDIFQNL
SAKQRLSLRRMVIDMVLATDMSKHMNLLADLKTMVETKKVTSLGVLLLDNYSDRIQVLQN
LVHCADLSNPTKPLPLYRQWTDRIMAEFFQQGDRERESGLDISPMCDKHTASVEKSQVGF
IDYIAHPLWETWADLVHPDAQDLLDTLEDNREWYQSKIPRSPSDLTNPERDGPDRFQFEL
TLEEAEEEDEEEEEEGEETALAKEALELPDTELLSPEAGPDPGDLPLDNQRT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggagaacctgggggtcggcgaaggggcagaggcttgcagcaggttgagtcgctctcgc
ggccgccacagcatgaccagagccccgaagcacctgtggcggcaaccccggcgccccatc
cgcatccaacagcgcttctattcggatccggacaagtccgcgggctgccgcgagagggac
ctgagcccgcggccggagctcaggaagtcgcggctctcctggcccgtttcctcctgcagg
cgctttgacctggaaaatgggctctcgtgtgggaggagggccctggaccctcagtccagc
cctggcctgggccggattatgcaggctccagtcccgcacagccagcggcgcgagtccttc
ctgtaccgctcagatagcgactatgaactctcgcccaaggccatgtctcggaactcctct
gtggccagcgacctacatggagaggacatgattgtgacgccctttgcccaggtcctggcc
agtctgcggaccgttcggagcaacgtggcggcccttgcccgccagcaatgcctaggagca
gccaagcagggacccgtcggaaacccttcatccagcaatcagctccctcctgcagaggac
acggggcagaagctggcattggagacgctagacgagctggactggtgcctggatcagttg
gagacgctgcagacccggcactcggtgggggagatggcctccaacaagttcaagcggatc
ctgaaccgggagttgacccacctgtccgaaaccagccgctccgggaaccaggtgtccgag
tacatctcccggaccttcctggaccagcagaccgaggtggagctgcccaaggtgaccgct
gaggaggccccacagcccatgtcccggatcagtggcctacatgggctctgccacagtgcc
agcctctcctcagccactgtcccacgctttggggtccagactgaccaggaggagcaactg
gccaaggagctagaagacaccaacaagtggggacttgatgtgttcaaggtggcggagcta
agtgggaaccggcccctcacagctatcatattcagcatttttcaggagcgggacctgctg
aagacattccagatcccagcagacacactggccacctacctgctgatgctggaaggtcac
taccacgccaatgtggcctaccacaacagcctacatgccgccgacgtggcccagtccacg
catgtgctgctggctacgcccgccctcgaggctgtgttcacagacttggaaatcctggct
gccctctttgcaagcgccatccacgacgtggaccatcctggggtctccaaccagtttctg
attaacaccaactcagagctggcgcttatgtacaacgacgcctcggtgctggagaaccat
cacctggctgtgggcttcaagctgctgcaggcagagaactgcgatatcttccagaacctc
agcgccaagcagcgactgagtctgcgcaggatggtcattgacatggtgctggccacagac
atgtccaaacacatgaacctcctggccgacctcaagaccatggtggagaccaagaaggtg
acaagcctcggtgtcctcctcctggacaactattccgaccgaatccaggtcttgcagaac
ctggtgcactgtgctgatctgagcaaccccaccaagccgctgcccctgtaccgccagtgg
acggaccgcatcatggccgagttcttccagcagggagaccgcgagcgtgagtcgggcctg
gacatcagtcccatgtgtgacaagcatacggcctcagtggagaagtcccaggtgggtttc
attgactacattgctcacccactgtgggagacttgggctgacctggtccacccagatgca
caggacctgctggacacgctggaggacaatcgagagtggtaccagagcaagatcccccga
agtccctcagacctcaccaaccccgagcgggacgggcctgacagattccagtttgaactg
actctggaggaggcagaggaagaggatgaggaggaagaagaggagggggaagagacagct
ttagccaaagaggccttggagttgcctgacactgaactcctgtcccctgaagccggccca
gaccctggggacttacccctcgacaaccagaggacttag

KEGG   Homo sapiens (human): 5144
Entry
5144              CDS       T01001                                 
Symbol
PDE4D, ACRDYS2, DPDE3, HSPDE4D, PDE43, PDE4DN2, STRK1
Name
(RefSeq) phosphodiesterase 4D
  KO
K13293  cAMP-specific phosphodiesterase 4 [EC:3.1.4.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
hsa04024  cAMP signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05032  Morphine addiction
Disease
H02211  Acrodysostosis
Drug target
Aminophylline (DG01062): D00227 D05429<JP> D11630<US>
Apremilast: D08860<JP/US>
Arofylline: D02985
Bemoradan: D03075
Bucladesine (DG00230): D01238<JP> D07546
Caffeine (DG00974): D00528<JP> D01453<JP> D07603<US>
Choline theophyllinate: D02017
Cilomilast: D01704
Cipamfylline: D03516
Crisaborole: D10873<US>
Difamilast: D11314<JP>
Diprophylline: D00691<JP>
Drotaverine (DG00044): D07088 D07879
Enprofylline: D04006
Ensifentrine: D11743
Etazolate hydrochloride: D02655
Filaminast: D04185
Flavoxate (DG00477): D00718<JP/US> D07961
Ibudilast: D01385<JP>
Lotamilast: D11305
Moxaverine (DG00045): D07089 D08238
Oxagrelate: D05278
Papaverine (DG00043): D02218<JP> D07425 D07439
Piclamilast: D05474
Prinoxodan: D05612
Propentofylline: D01630
Proxyphylline: D01771<JP>
Roflumilast: D05744<US>
Rolipram: D01783
Theophylline (DG01061): D00371<JP/US> D01712 D06103 D06104
Theosalicin: D09822
Tibenelast sodium: D06132
Tofimilast: D09020
Trapidil: D01220<JP>
Zatolmilast: D12173
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    5144 (PDE4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    5144 (PDE4D)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    5144 (PDE4D)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    5144 (PDE4D)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.53  3',5'-cyclic-AMP phosphodiesterase
     5144 (PDE4D)
SSDB
Motif
Pfam: PDEase_I PDE4_UCR
Other DBs
NCBI-GeneID: 5144
NCBI-ProteinID: NP_001098101
OMIM: 600129
HGNC: 8783
Ensembl: ENSG00000113448
Vega: OTTHUMG00000162218
Pharos: Q08499(Tclin)
UniProt: Q08499 A0A140VJR0
Structure
LinkDB
Position
5:complement(58969038..60522128)
AA seq 809 aa
MEAEGSSAPARAGSGEGSDSAGGATLKAPKHLWRHEQHHQYPLRQPQFRLLHPHHHLPPP
PPPSPQPQPQCPLQPPPPPPLPPPPPPPGAARGRYASSGATGRVRHRGYSDTERYLYCRA
MDRTSYAVETGHRPGLKKSRMSWPSSFQGLRRFDVDNGTSAGRSPLDPMTSPGSGLILQA
NFVHSQRRESFLYRSDSDYDLSPKSMSRNSSIASDIHGDDLIVTPFAQVLASLRTVRNNF
AALTNLQDRAPSKRSPMCNQPSINKATITEEAYQKLASETLEELDWCLDQLETLQTRHSV
SEMASNKFKRMLNRELTHLSEMSRSGNQVSEFISNTFLDKQHEVEIPSPTQKEKEKKKRP
MSQISGVKKLMHSSSLTNSSIPRFGVKTEQEDVLAKELEDVNKWGLHVFRIAELSGNRPL
TVIMHTIFQERDLLKTFKIPVDTLITYLMTLEDHYHADVAYHNNIHAADVVQSTHVLLST
PALEAVFTDLEILAAIFASAIHDVDHPGVSNQFLINTNSELALMYNDSSVLENHHLAVGF
KLLQEENCDIFQNLTKKQRQSLRKMVIDIVLATDMSKHMNLLADLKTMVETKKVTSSGVL
LLDNYSDRIQVLQNMVHCADLSNPTKPLQLYRQWTDRIMEEFFRQGDRERERGMEISPMC
DKHNASVEKSQVGFIDYIVHPLWETWADLVHPDAQDILDTLEDNREWYQSTIPQSPSPAP
DDPEEGRQGQTEKFQFELTLEEDGESDTEKDSGSQVEEDTSCSDSKTLCTQDSESTEIPL
DEQVEEEAVGEEEESQPEACVIDDRSPDT
NT seq 2430 nt   +upstreamnt  +downstreamnt
atggaggcagagggcagcagcgcgccggcccgggcgggcagcggagagggcagcgacagc
gccggcggggccacgctcaaagcccccaagcatctctggaggcacgagcagcaccaccag
tacccgctccggcagccccagttccgcctcctgcatccccatcaccacctgcccccgccg
ccgccaccctcgccccagccccagccccagtgtccgctacagccgccgccgccgcccccc
ctgccgccgcccccgccgccgcccggggctgcccgcggccgctacgcctcgagcggggcc
accggccgcgtccggcatcgcggctactcggacaccgagcgctacctgtactgtcgcgcc
atggaccgcacctcctacgcggtggagaccggccaccggcccggcctgaagaaatccagg
atgtcctggccctcctcgttccagggactcaggcgttttgatgtggacaatggcacatct
gcgggacggagtcccttggatcccatgaccagcccaggatccgggctaattctccaagca
aattttgtccacagtcaacgacgggagtccttcctgtatcgatccgacagcgattatgac
ctctctccaaagtctatgtcccggaactcctccattgccagtgatatacacggagatgac
ttgattgtgactccatttgctcaggtcttggccagtctgcgaactgtacgaaacaacttt
gctgcattaactaatttgcaagatcgagcacctagcaaaagatcacccatgtgcaaccaa
ccatccatcaacaaagccaccataacagaggaggcctaccagaaactggccagcgagacc
ctggaggagctggactggtgtctggaccagctagagaccctacagaccaggcactccgtc
agtgagatggcctccaacaagtttaaaaggatgcttaatcgggagctcacccatctctct
gaaatgagtcggtctggaaatcaagtgtcagagtttatatcaaacacattcttagataag
caacatgaagtggaaattccttctccaactcagaaggaaaaggagaaaaagaaaagacca
atgtctcagatcagtggagtcaagaaattgatgcacagctctagtctgactaattcaagt
atcccaaggtttggagttaaaactgaacaagaagatgtccttgccaaggaactagaagat
gtgaacaaatggggtcttcatgttttcagaatagcagagttgtctggtaaccggcccttg
actgttatcatgcacaccatttttcaggaacgggatttattaaaaacatttaaaattcca
gtagatactttaattacatatcttatgactctcgaagaccattaccatgctgatgtggcc
tatcacaacaatatccatgctgcagatgttgtccagtctactcatgtgctattatctaca
cctgctttggaggctgtgtttacagatttggagattcttgcagcaatttttgccagtgca
atacatgatgtagatcatcctggtgtgtccaatcaatttctgatcaatacaaactctgaa
cttgccttgatgtacaatgattcctcagtcttagagaaccatcatttggctgtgggcttt
aaattgcttcaggaagaaaactgtgacattttccagaatttgaccaaaaaacaaagacaa
tctttaaggaaaatggtcattgacatcgtacttgcaacagatatgtcaaaacacatgaat
ctactggctgatttgaagactatggttgaaactaagaaagtgacaagctctggagttctt
cttcttgataattattccgataggattcaggttcttcagaatatggtgcactgtgcagat
ctgagcaacccaacaaagcctctccagctgtaccgccagtggacggaccggataatggag
gagttcttccgccaaggagaccgagagagggaacgtggcatggagataagccccatgtgt
gacaagcacaatgcttccgtggaaaaatcacaggtgggcttcatagactatattgttcat
cccctctgggagacatgggcagacctcgtccaccctgacgcccaggatattttggacact
ttggaggacaatcgtgaatggtaccagagcacaatccctcagagcccctctcctgcacct
gatgacccagaggagggccggcagggtcaaactgagaaattccagtttgaactaacttta
gaggaagatggtgagtcagacacggaaaaggacagtggcagtcaagtggaagaagacact
agctgcagtgactccaagactctttgtactcaagactcagagtctactgaaattcccctt
gatgaacaggttgaagaggaggcagtaggggaagaagaggaaagccagcctgaagcctgt
gtcatagatgatcgttctcctgacacgtaa

DBGET integrated database retrieval system