KEGG   Homo sapiens (human): 55584
Entry
55584             CDS       T01001                                 
Symbol
CHRNA9, HSA243342, NACHRA9
Name
(RefSeq) cholinergic receptor nicotinic alpha 9 subunit
  KO
K04810  nicotinic acetylcholine receptor alpha-9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06210  ERK signaling
nt06214  PI3K signaling
  Element
N01350  NNK/NNN to PI3K signaling pathway
N01353  E2 to RAS-ERK signaling pathway
Drug target
Acetylcholine (DG01133): D00999<JP/US>
Atracurium (DG00771): D00758<US>
Cisatracurium: D00759<US>
Cytisinicline: D07770
Dimethyltubocurarine: D07272
Doxacurium chloride: D00760
Fazadinium bromide: D07273
Hexamethonium bromide: D02204
Lobeline (DG01287): D02202 D02364 D08138
Mecamylamine (DG00252): D00611<US>
Mivacurium chloride: D00763
Nicotine (DG00994): D03365<JP/US> D05156 D05157
Pancuronium (DG00769): D00492<US>
Pipecuronium bromide: D00764
Rocuronium bromide: D00765<JP/US>
Tubocurarine (DG00767): D02207 D08655
Vecuronium (DG00770): D00767<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    55584 (CHRNA9)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    55584 (CHRNA9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    55584 (CHRNA9)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   55584 (CHRNA9)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF5665
Other DBs
NCBI-GeneID: 55584
NCBI-ProteinID: NP_060051
OMIM: 605116
HGNC: 14079
Ensembl: ENSG00000174343
Vega: OTTHUMG00000099375
Pharos: Q9UGM1(Tbio)
UniProt: Q9UGM1
Structure
LinkDB
Position
4:40335333..40355217
AA seq 479 aa
MNWSHSCISFCWIYFAASRLRAAETADGKYAQKLFNDLFEDYSNALRPVEDTDKVLNVTL
QITLSQIKDMDERNQILTAYLWIRQIWHDAYLTWDRDQYDGLDSIRIPSDLVWRPDIVLY
NKADDESSEPVNTNVVLRYDGLITWDAPAITKSSCVVDVTYFPFDNQQCNLTFGSWTYNG
NQVDIFNALDSGDLSDFIEDVEWEVHGMPAVKNVISYGCCSEPYPDVTFTLLLKRRSSFY
IVNLLIPCVLISFLAPLSFYLPAASGEKVSLGVTILLAMTVFQLMVAEIMPASENVPLIG
KYYIATMALITASTALTIMVMNIHFCGAEARPVPHWARVVILKYMSRVLFVYDVGESCLS
PHHSRERDHLTKVYSKLPESNLKAARNKDLSRKKDMNKRLKNDLGCQGKNPQEAESYCAQ
YKVLTRNIEYIAKCLKDHKATNSKGSEWKKVAKVIDRFFMWIFFIMVFVMTILIIARAD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgaactggtcccattcctgcatctccttttgctggatctactttgctgcttccagactg
agagctgcagagacggcagatggaaaatatgctcagaagttgtttaatgacctttttgaa
gattattctaatgctcttcgtccagtggaagatacagataaagtcctgaatgtgaccctg
cagattacgctctctcagattaaggatatggatgaaagaaaccaaattctgactgcttat
ttgtggatccgccaaatctggcacgatgcctatctcacgtgggaccgagatcagtacgat
ggcctagactccatcaggatccccagtgacctcgtgtggaggccagacatcgtcttatat
aacaaggctgatgatgaatcttcagagcctgtgaacaccaatgtggtcctgcggtatgat
gggctgatcacctgggatgcaccggccatcaccaaaagctcctgtgtggtggatgtcacc
tacttcccttttgacaaccagcagtgcaacctgacttttggttcctggacctacaatggc
aatcaggtggacatattcaacgccttggacagcggagatctctctgacttcattgaagat
gtggaatgggaggtccatggcatgcccgctgtgaagaatgtgatctcctatggctgctgc
tctgagccttacccggatgtcacattcaccctccttctgaagaggaggtcctcgttctat
atcgtcaacctcctcatcccatgcgtcctcatatcttttctggctcctctgagtttttat
ctcccagcagcctccggagaaaaggtctccctgggagtgaccatcctgttggccatgact
gtatttcagctaatggtggcagaaatcatgccggcctcagaaaatgtgcccctgataggt
aaatactacatagccacgatggccctgatcacagcctccactgcgttgaccatcatggtg
atgaatatccacttctgtggggccgaggcccggccggtgccacactgggccagggtggtc
atcctgaaatacatgtccagggtcttgtttgtctatgatgtgggtgaaagctgcctcagc
ccgcaccacagtagagagcgggaccacctcacgaaagtttatagcaaactcccagagtct
aacctgaaagcagccaggaacaaagacctttccagaaagaaggacatgaacaaacgctta
aagaacgacctgggctgccagggtaagaaccctcaggaggccgagagttactgtgcacag
tacaaagtgctgacgaggaatattgagtacatcgccaagtgcctcaaagaccacaaggcc
accaattccaaggggagtgaatggaagaaggtggcgaaagtcatagaccgattcttcatg
tggatttttttcattatggtgtttgtgatgactattttgatcatagcaagagcggattag

DBGET integrated database retrieval system