Homo sapiens (human): 578 Help Entry 578               CDS       T01001                                  Symbol BAK1, BAK, BAK-LIKE, BCL2L7, CDN1 Name (RefSeq) BCL2 antagonist/killer 1   KO K14021   Bcl-2 homologous antagonist/killer Organism hsa  Homo sapiens (human) Pathway hsa01524   Platinum drug resistance hsa04141   Protein processing in endoplasmic reticulum hsa04210   Apoptosis hsa04215   Apoptosis - multiple species hsa05022   Pathways of neurodegeneration - multiple diseases hsa05130   Pathogenic Escherichia coli infection hsa05132   Salmonella infection hsa05160   Hepatitis C hsa05162   Measles hsa05163   Human cytomegalovirus infection hsa05164   Influenza A hsa05165   Human papillomavirus infection hsa05167   Kaposi sarcoma-associated herpesvirus infection hsa05168   Herpes simplex virus 1 infection hsa05169   Epstein-Barr virus infection hsa05170   Human immunodeficiency virus 1 infection hsa05200   Pathways in cancer hsa05202   Transcriptional misregulation in cancer hsa05203   Viral carcinogenesis hsa05206   MicroRNAs in cancer hsa05210   Colorectal cancer hsa05212   Pancreatic cancer hsa05213   Endometrial cancer hsa05214   Glioma hsa05216   Thyroid cancer hsa05217   Basal cell carcinoma hsa05218   Melanoma hsa05220   Chronic myeloid leukemia hsa05222   Small cell lung cancer hsa05223   Non-small cell lung cancer hsa05224   Breast cancer hsa05225   Hepatocellular carcinoma hsa05226   Gastric cancer Network   Element N00098   Intrinsic apoptotic pathway N00115   Mutation-inactivated TP53 to transcription N00146   Crosstalk between extrinsic and intrinsic apoptotic pathways N00164   KSHV vBCL2 to crosstalk between extrinsic and intrinsic apoptotic pathways N00223   EBV EBNA1 to p53-mediated transcription N00263   EBV EBNA3C to p53-mediated transcription N00383   HPV E6 to intrinsic apoptotic pathway N00449   HIV Tat/Nef to crosstalk between extrinsic and intrinsic apoptotic pathways N00476   EBV BHRF1 to intrinsic apoptotic pathway N00478   EBV BARF1 to intrinsic apoptotic pathway N00481   EBV BZLF1 to p53-mediated transcription N01005   Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways N01135   Mutation-caused aberrant SOD1 to intrinsic apoptotic pathway Brite KEGG Orthology (KO) [BR:hsa00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     578 (BAK1)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     578 (BAK1)    04215 Apoptosis - multiple species     578 (BAK1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     578 (BAK1)    05202 Transcriptional misregulation in cancer     578 (BAK1)    05206 MicroRNAs in cancer     578 (BAK1)    05203 Viral carcinogenesis     578 (BAK1)   09162 Cancer: specific types    05210 Colorectal cancer     578 (BAK1)    05212 Pancreatic cancer     578 (BAK1)    05225 Hepatocellular carcinoma     578 (BAK1)    05226 Gastric cancer     578 (BAK1)    05214 Glioma     578 (BAK1)    05216 Thyroid cancer     578 (BAK1)    05220 Chronic myeloid leukemia     578 (BAK1)    05217 Basal cell carcinoma     578 (BAK1)    05218 Melanoma     578 (BAK1)    05213 Endometrial cancer     578 (BAK1)    05224 Breast cancer     578 (BAK1)    05222 Small cell lung cancer     578 (BAK1)    05223 Non-small cell lung cancer     578 (BAK1)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     578 (BAK1)    05160 Hepatitis C     578 (BAK1)    05164 Influenza A     578 (BAK1)    05162 Measles     578 (BAK1)    05168 Herpes simplex virus 1 infection     578 (BAK1)    05163 Human cytomegalovirus infection     578 (BAK1)    05167 Kaposi sarcoma-associated herpesvirus infection     578 (BAK1)    05169 Epstein-Barr virus infection     578 (BAK1)    05165 Human papillomavirus infection     578 (BAK1)   09171 Infectious disease: bacterial    05130 Pathogenic Escherichia coli infection     578 (BAK1)    05132 Salmonella infection     578 (BAK1)   09164 Neurodegenerative disease    05022 Pathways of neurodegeneration - multiple diseases     578 (BAK1)   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     578 (BAK1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hsa03029]     578 (BAK1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hsa02000]     578 (BAK1) Mitochondrial biogenesis [BR:hsa03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     578 (BAK1) Transporters [BR:hsa02000]  Other transporters   Pores ion channels [TC:1]    578 (BAK1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bcl-2 Bcl-2_3 DUF5700 Motif Other DBs NCBI-GeneID:  578 NCBI-ProteinID:  NP_001179 OMIM:  600516 HGNC:  949 Ensembl:  ENSG00000030110 UniProt:  Q16611 A0A0S2Z391 Structure PDB LinkDB All DBs Position 6:complement(33572552..33580276) Genome browser AA seq 211 aa AA seqDB search MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcggggcaaggcccaggtcctcccaggcaggagtgcggagagcctgccctgccc tctgcttctgaggagcaggtagcccaggacacagaggaggttttccgcagctacgttttt taccgccatcagcaggaacaggaggctgaaggggtggctgcccctgccgacccagagatg gtcaccttacctctgcaacctagcagcaccatggggcaggtgggacggcagctcgccatc atcggggacgacatcaaccgacgctatgactcagagttccagaccatgttgcagcacctg cagcccacggcagagaatgcctatgagtacttcaccaagattgccaccagcctgtttgag agtggcatcaattggggccgtgtggtggctcttctgggcttcggctaccgtctggcccta cacgtctaccagcatggcctgactggcttcctaggccaggtgacccgcttcgtggtcgac ttcatgctgcatcactgcattgcccggtggattgcacagaggggtggctgggtggcagcc ctgaacttgggcaatggtcccatcctgaacgtgctggtggttctgggtgtggttctgttg ggccagtttgtggtacgaagattcttcaaatcatga

DBGET integrated database retrieval system