KEGG   Homo sapiens (human): 712
Entry
712               CDS       T01001                                 

Gene name
C1QA
Definition
(RefSeq) complement C1q A chain
  KO
K03986  complement C1q subcomponent subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H01357  Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    712 (C1QA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    712 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712 (C1QA)
   05150 Staphylococcus aureus infection
    712 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    712 (C1QA)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    712 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion disease
    712 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    712 (C1QA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    712 (C1QA)
SSDB
Motif
Pfam: C1q Collagen TNF
Other DBs
NCBI-GeneID: 712
NCBI-ProteinID: NP_001334394
OMIM: 120550
HGNC: 1241
Ensembl: ENSG00000173372
Vega: OTTHUMG00000002893
Pharos: P02745(Tbio)
UniProt: P02745 A0A024RAG6
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR
TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI
RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR
GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagggtccccggggatggctggtgctctgtgtgctggccatatcgctggcctctatg
gtgaccgaggacttgtgccgagcaccagacgggaagaaaggggaggcaggaagacctggc
agacgggggcggccaggcctcaagggggagcaaggggagccgggggcccctggcatccgg
acaggcatccaaggccttaaaggagaccagggggaacctgggccctctggaaaccccggc
aaggtgggctacccagggcccagcggccccctcggagcccgtggcatcccgggaattaaa
ggcaccaagggcagcccaggaaacatcaaggaccagccgaggccagccttctccgccatt
cggcggaaccccccaatggggggcaacgtggtcatcttcgacacggtcatcaccaaccag
gaagaaccgtaccagaaccactccggccgattcgtctgcactgtacccggctactactac
ttcaccttccaggtgctgtcccagtgggaaatctgcctgtccatcgtctcctcctcaagg
ggccaggtccgacgctccctgggcttctgtgacaccaccaacaaggggctcttccaggtg
gtgtcagggggcatggtgcttcagctgcagcagggtgaccaggtctgggttgaaaaagac
cccaaaaagggtcacatttaccagggctctgaggccgacagcgtcttcagcggcttcctc
atcttcccatctgcctga

KEGG   Homo sapiens (human): 713
Entry
713               CDS       T01001                                 

Gene name
C1QB
Definition
(RefSeq) complement C1q B chain
  KO
K03987  complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    713 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    713 (C1QB)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    713 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    713 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    713 (C1QB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    713 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 713
NCBI-ProteinID: NP_000482
OMIM: 120570
HGNC: 1242
Ensembl: ENSG00000173369
Vega: OTTHUMG00000002896
Pharos: P02746(Tbio)
UniProt: P02746 A0A024RAB9
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 253 aa
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

KEGG   Homo sapiens (human): 714
Entry
714               CDS       T01001                                 

Gene name
C1QC, C1Q-C, C1QG
Definition
(RefSeq) complement C1q C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    714 (C1QC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    714 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    714 (C1QC)
   05150 Staphylococcus aureus infection
    714 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    714 (C1QC)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    714 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion disease
    714 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    714 (C1QC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    714 (C1QC)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 714
NCBI-ProteinID: NP_001107573
OMIM: 120575
HGNC: 1245
Ensembl: ENSG00000159189
Vega: OTTHUMG00000002891
Pharos: P02747(Tbio)
UniProt: P02747 A0A024RAA7
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacgtggggcccagctccctgccccaccttgggctgaagctgctgctgctcctgctg
ctgctgcccctcaggggccaagccaacacaggctgctacgggatcccagggatgcccggc
ctgcccggggcaccagggaaggatgggtacgacggactgccggggcccaagggggagcca
ggaatcccagccattcccgggatccgaggacccaaagggcagaagggagaacccggctta
cccggccatcctgggaaaaatggccccatgggaccccctgggatgccaggggtgcccggc
cccatgggcatccctggagagccaggtgaggagggcagatacaagcagaaattccagtca
gtgttcacggtcactcggcagacccaccagccccctgcacccaacagcctgatcagattc
aacgcggtcctcaccaacccgcagggagattatgacacgagcactggcaagttcacctgc
aaagtccccggcctctactactttgtctaccacgcgtcgcatacagccaacctgtgcgtg
ctgctgtaccgcagcggcgtcaaagtggtcaccttctgtggccacacgtccaaaaccaat
caggtcaactcgggcggtgtgctgctgaggttgcaggtgggcgaggaggtgtggctggct
gtcaatgactactacgacatggtgggcatccagggctctgacagcgtcttctccggcttc
ctgctcttccccgactag

KEGG   Homo sapiens (human): 715
Entry
715               CDS       T01001                                 

Gene name
C1R, EDSPD1
Definition
(RefSeq) complement C1r
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    715 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    715 (C1R)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    715 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    715 (C1R)
   05150 Staphylococcus aureus infection
    715 (C1R)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    715 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    715 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    715 (C1R)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     715 (C1R)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   715 (C1R)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    715 (C1R)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF Trypsin_2
Other DBs
NCBI-GeneID: 715
NCBI-ProteinID: NP_001724
OMIM: 613785
HGNC: 1246
Ensembl: ENSG00000159403
Vega: OTTHUMG00000168149
Pharos: P00736(Tclin)
UniProt: P00736
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 705 aa
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgtggctcttgtacctcctggtgccggccctgttctgcagggcaggaggctccattccc
atccctcagaagttatttggggaggtgacttcccctctgttccccaagccttaccccaac
aactttgaaacaaccactgtgatcacagtccccacgggatacagggtgaagctcgtcttc
cagcagtttgacctggagccttctgaaggctgcttctatgattatgtcaagatctctgct
gataagaaaagcctggggaggttctgtgggcaactgggttctccactgggcaaccccccg
ggaaagaaggaatttatgtcccaagggaacaagatgctgctgaccttccacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaagct
gtggaccttgatgaatgtgcttcccggagcaaatcaggggaggaggatccccagccccag
tgccagcacctgtgtcacaactacgttggaggctacttctgttcctgccgtccaggctat
gagcttcaggaagacaggcattcctgccaggctgagtgcagcagcgagctgtacacggag
gcatcaggctacatctccagcctggagtaccctcggtcctacccccctgacctgcgctgc
aactacagcatccgggtggagcggggcctcaccctgcacctcaagttcctggagcctttt
gatattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccaac
gggaagaacattggcgagttctgtgggaagcaaaggccccccgacctcgacaccagcagc
aatgctgtggatctgctgttcttcacagatgagtcgggggacagccggggctggaagctg
cgctacaccaccgagatcatcaagtgcccccagcccaagaccctagacgagttcaccatc
atccagaacctgcagcctcagtaccagttccgtgactacttcattgctacctgcaagcaa
ggctaccagctcatagaggggaaccaggtgctgcattccttcacagctgtctgccaggat
gatggcacgtggcatcgtgccatgcccagatgcaagatcaaggactgtgggcagccccga
aacctgcctaatggtgacttccgttacaccaccacaatgggagtgaacacctacaaggcc
cgtatccagtactactgccatgagccatattacaagatgcagaccagagctggcagcagg
gagtctgagcaaggggtgtacacctgcacagcacagggcatttggaagaatgaacagaag
ggagagaagattcctcggtgcttgccagtgtgtgggaagcccgtgaaccccgtggaacag
aggcagcgcatcatcggagggcaaaaagccaagatgggcaacttcccctggcaggtgttc
accaacatccacgggcgcgggggcggggccctgctgggcgaccgctggatcctcacagct
gcccacaccctgtatcccaaggaacacgaagcgcaaagcaacgcctctttggatgtgttc
ctgggccacacaaatgtggaagagctcatgaagctaggaaatcaccccatccgcagggtc
agcgtccacccggactaccgtcaggatgagtcctacaattttgagggggacatcgccctg
ctggagctggaaaatagtgtcaccctgggtcccaacctcctccccatctgcctccctgac
aacgataccttctacgacctgggcttgatgggctatgtcagtggcttcggggtcatggag
gagaagattgctcatgacctcaggtttgtccgtctgcccgtagctaatccacaggcctgt
gagaactggctccggggaaagaataggatggatgtgttctctcaaaacatgttctgtgct
ggacacccatctctaaagcaggacgcctgccagggggatagtgggggcgtttttgcagta
agggacccgaacactgatcgctgggtggccacgggcatcgtgtcctggggcatcgggtgc
agcaggggctatggcttctacaccaaagtgctcaactacgtggactggatcaagaaagag
atggaggaggaggactga

KEGG   Homo sapiens (human): 716
Entry
716               CDS       T01001                                 

Gene name
C1S, EDSPD2
Definition
(RefSeq) complement C1s
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845<US>
Sutimlimab: D11530
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    716 (C1S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    716 (C1S)
  09171 Infectious disease: bacterial
   05133 Pertussis
    716 (C1S)
   05150 Staphylococcus aureus infection
    716 (C1S)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    716 (C1S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    716 (C1S)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    716 (C1S)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     716 (C1S)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   716 (C1S)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    716 (C1S)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 hEGF
Other DBs
NCBI-GeneID: 716
NCBI-ProteinID: NP_001725
OMIM: 120580
HGNC: 1247
Ensembl: ENSG00000182326
Vega: OTTHUMG00000150305
Pharos: P09871(Tchem)
UniProt: P09871
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 688 aa
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtggtgcattgtcctgttttcacttttggcatgggtttatgctgagcctaccatgtat
ggggagatcctgtcccctaactatcctcaggcatatcccagtgaggtagagaaatcttgg
gacatagaagttcctgaagggtatgggattcacctctacttcacccatctggacattgag
ctgtcagagaactgtgcgtatgactcagtgcagataatctcaggagacactgaagaaggg
aggctctgtggacagaggagcagtaacaatccccactctccaattgtggaagagttccaa
gtcccatacaacaaactccaggtgatctttaagtcagacttttccaatgaagagcgtttt
acggggtttgctgcatactatgttgccacagacataaatgaatgcacagattttgtagat
gtcccttgtagccacttctgcaacaatttcattggtggttacttctgctcctgccccccg
gaatatttcctccatgatgacatgaagaattgcggagttaattgcagtggggatgtattc
actgcactgattggggagattgcaagtcccaattatcccaaaccatatccagagaactca
aggtgtgaataccagatccggttggagaaagggttccaagtggtggtgaccttgcggaga
gaagattttgatgtggaagcagctgactcagcgggaaactgccttgacagtttagttttt
gttgcaggagatcggcaatttggtccttactgtggtcatggattccctgggcctctaaat
attgaaaccaagagtaatgctcttgatatcatcttccaaactgatctaacagggcaaaaa
aagggctggaaacttcgctatcatggagatccaatgccctgccctaaggaagacactccc
aattctgtttgggagcctgcgaaggcaaaatatgtctttagagatgtggtgcagataacc
tgtctggatgggtttgaagttgtggagggacgtgttggtgcaacatctttctattcgact
tgtcaaagcaatggaaagtggagtaattccaaactgaaatgtcaacctgtggactgtggc
attcctgaatccattgagaatggtaaagttgaagacccagagagcactttgtttggttct
gtcatccgctacacttgtgaggagccatattactacatggaaaatggaggaggtggggag
tatcactgtgctggtaacgggagctgggtgaatgaggtgctgggcccggagctgccgaaa
tgtgttccagtctgtggagtccccagagaaccctttgaagaaaaacagaggataattgga
ggatccgatgcagatattaaaaacttcccctggcaagtcttctttgacaacccatgggct
ggtggagcgctcattaatgagtactgggtgctgacggctgctcatgttgtggagggaaac
agggagccaacaatgtatgttgggtccacctcagtgcagacctcacggctggcaaaatcc
aagatgctcactcctgagcatgtgtttattcatccgggatggaagctgctggaagtccca
gaaggacgaaccaattttgataatgacattgcactggtgcggctgaaagacccagtgaaa
atgggacccaccgtctctcccatctgcctaccaggcacctcttccgactacaacctcatg
gatggggacctgggactgatctcaggctggggccgaacagagaagagagatcgtgctgtt
cgcctcaaggcggcaaggttacctgtagctcctttaagaaaatgcaaagaagtgaaagtg
gagaaacccacagcagatgcagaggcctatgttttcactcctaacatgatctgtgctgga
ggagagaagggcatggatagctgtaaaggggacagtggtggggcctttgctgtacaggat
cccaatgacaagaccaaattctacgcagctggcctggtgtcctgggggccccagtgtggg
acctatgggctctacacacgggtaaagaactatgttgactggataatgaagactatgcag
gaaaatagcaccccccgtgaggactaa

DBGET integrated database retrieval system