KEGG   Homo sapiens (human): 712
Entry
712               CDS       T01001                                 

Symbol
C1QA
Name
(RefSeq) complement C1q A chain
  KO
K03986  complement C1q subcomponent subunit A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H01357  Allergic contact dermatitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    712 (C1QA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    712 (C1QA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    712 (C1QA)
   05150 Staphylococcus aureus infection
    712 (C1QA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    712 (C1QA)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    712 (C1QA)
  09164 Neurodegenerative disease
   05020 Prion disease
    712 (C1QA)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    712 (C1QA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    712 (C1QA)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    712 (C1QA)
SSDB
Motif
Pfam: C1q Collagen TNF
Other DBs
NCBI-GeneID: 712
NCBI-ProteinID: NP_001334394
OMIM: 120550
HGNC: 1241
Ensembl: ENSG00000173372
Vega: OTTHUMG00000002893
Pharos: P02745(Tbio)
UniProt: P02745 A0A024RAG6
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MEGPRGWLVLCVLAISLASMVTEDLCRAPDGKKGEAGRPGRRGRPGLKGEQGEPGAPGIR
TGIQGLKGDQGEPGPSGNPGKVGYPGPSGPLGARGIPGIKGTKGSPGNIKDQPRPAFSAI
RRNPPMGGNVVIFDTVITNQEEPYQNHSGRFVCTVPGYYYFTFQVLSQWEICLSIVSSSR
GQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKDPKKGHIYQGSEADSVFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagggtccccggggatggctggtgctctgtgtgctggccatatcgctggcctctatg
gtgaccgaggacttgtgccgagcaccagacgggaagaaaggggaggcaggaagacctggc
agacgggggcggccaggcctcaagggggagcaaggggagccgggggcccctggcatccgg
acaggcatccaaggccttaaaggagaccagggggaacctgggccctctggaaaccccggc
aaggtgggctacccagggcccagcggccccctcggagcccgtggcatcccgggaattaaa
ggcaccaagggcagcccaggaaacatcaaggaccagccgaggccagccttctccgccatt
cggcggaaccccccaatggggggcaacgtggtcatcttcgacacggtcatcaccaaccag
gaagaaccgtaccagaaccactccggccgattcgtctgcactgtacccggctactactac
ttcaccttccaggtgctgtcccagtgggaaatctgcctgtccatcgtctcctcctcaagg
ggccaggtccgacgctccctgggcttctgtgacaccaccaacaaggggctcttccaggtg
gtgtcagggggcatggtgcttcagctgcagcagggtgaccaggtctgggttgaaaaagac
cccaaaaagggtcacatttaccagggctctgaggccgacagcgtcttcagcggcttcctc
atcttcccatctgcctga

KEGG   Homo sapiens (human): 713
Entry
713               CDS       T01001                                 

Symbol
C1QB
Name
(RefSeq) complement C1q B chain
  KO
K03987  complement C1q subcomponent subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    713 (C1QB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    713 (C1QB)
  09171 Infectious disease: bacterial
   05133 Pertussis
    713 (C1QB)
   05150 Staphylococcus aureus infection
    713 (C1QB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    713 (C1QB)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    713 (C1QB)
  09164 Neurodegenerative disease
   05020 Prion disease
    713 (C1QB)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    713 (C1QB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    713 (C1QB)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    713 (C1QB)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 713
NCBI-ProteinID: NP_000482
OMIM: 120570
HGNC: 1242
Ensembl: ENSG00000173369
Vega: OTTHUMG00000002896
Pharos: P02746(Tbio)
UniProt: P02746 A0A024RAB9
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 253 aa
MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKG
EKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQ
KIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNL
CVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANS
IFSGFLLFPDMEA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgatgatgaagatcccatggggcagcatcccagtactgatgttgctcctgctcctgggc
ctaatcgatatctcccaggcccagctcagctgcaccgggcccccagccatccctggcatc
ccgggtatccctgggacacctggccccgatggccaacctgggaccccagggataaaagga
gagaaagggcttccagggctggctggagaccatggtgagttcggagagaagggagaccca
gggattcctgggaatccaggaaaagtcggccccaagggccccatgggccctaaaggtggc
ccaggggcccctggagccccaggccccaaaggtgaatcgggagactacaaggccacccag
aaaatcgccttctctgccacaagaaccatcaacgtccccctgcgccgggaccagaccatc
cgcttcgaccacgtgatcaccaacatgaacaacaattatgagccccgcagtggcaagttc
acctgcaaggtgcccggtctctactacttcacctaccacgccagctctcgagggaacctg
tgcgtgaacctcatgcgtggccgggagcgtgcacagaaggtggtcaccttctgtgactat
gcctacaacaccttccaggtcaccaccggtggcatggtcctcaagctggagcagggggag
aacgtcttcctgcaggccaccgacaagaactcactactgggcatggagggtgccaacagc
atcttttccgggttcctgctctttccagatatggaggcctga

KEGG   Homo sapiens (human): 714
Entry
714               CDS       T01001                                 

Symbol
C1QC, C1Q-C, C1QG
Name
(RefSeq) complement C1q C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa04936  Alcoholic liver disease
hsa05020  Prion disease
hsa05133  Pertussis
hsa05142  Chagas disease
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    714 (C1QC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    714 (C1QC)
  09171 Infectious disease: bacterial
   05133 Pertussis
    714 (C1QC)
   05150 Staphylococcus aureus infection
    714 (C1QC)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    714 (C1QC)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    714 (C1QC)
  09164 Neurodegenerative disease
   05020 Prion disease
    714 (C1QC)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    714 (C1QC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    714 (C1QC)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    714 (C1QC)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 714
NCBI-ProteinID: NP_001107573
OMIM: 120575
HGNC: 1245
Ensembl: ENSG00000159189
Vega: OTTHUMG00000002891
Pharos: P02747(Tbio)
UniProt: P02747 A0A024RAA7
LinkDB
Structure
PDB: 

Position
1p36.12
AA seq 245 aa
MDVGPSSLPHLGLKLLLLLLLLPLRGQANTGCYGIPGMPGLPGAPGKDGYDGLPGPKGEP
GIPAIPGIRGPKGQKGEPGLPGHPGKNGPMGPPGMPGVPGPMGIPGEPGEEGRYKQKFQS
VFTVTRQTHQPPAPNSLIRFNAVLTNPQGDYDTSTGKFTCKVPGLYYFVYHASHTANLCV
LLYRSGVKVVTFCGHTSKTNQVNSGGVLLRLQVGEEVWLAVNDYYDMVGIQGSDSVFSGF
LLFPD
NT seq 738 nt   +upstreamnt  +downstreamnt
atggacgtggggcccagctccctgccccaccttgggctgaagctgctgctgctcctgctg
ctgctgcccctcaggggccaagccaacacaggctgctacgggatcccagggatgcccggc
ctgcccggggcaccagggaaggatgggtacgacggactgccggggcccaagggggagcca
ggaatcccagccattcccgggatccgaggacccaaagggcagaagggagaacccggctta
cccggccatcctgggaaaaatggccccatgggaccccctgggatgccaggggtgcccggc
cccatgggcatccctggagagccaggtgaggagggcagatacaagcagaaattccagtca
gtgttcacggtcactcggcagacccaccagccccctgcacccaacagcctgatcagattc
aacgcggtcctcaccaacccgcagggagattatgacacgagcactggcaagttcacctgc
aaagtccccggcctctactactttgtctaccacgcgtcgcatacagccaacctgtgcgtg
ctgctgtaccgcagcggcgtcaaagtggtcaccttctgtggccacacgtccaaaaccaat
caggtcaactcgggcggtgtgctgctgaggttgcaggtgggcgaggaggtgtggctggct
gtcaatgactactacgacatggtgggcatccagggctctgacagcgtcttctccggcttc
ctgctcttccccgactag

KEGG   Homo sapiens (human): 715
Entry
715               CDS       T01001                                 

Symbol
C1R, EDSPD1
Name
(RefSeq) complement C1r
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    715 (C1R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    715 (C1R)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    715 (C1R)
  09171 Infectious disease: bacterial
   05133 Pertussis
    715 (C1R)
   05150 Staphylococcus aureus infection
    715 (C1R)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    715 (C1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    715 (C1R)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    715 (C1R)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     715 (C1R)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   715 (C1R)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    715 (C1R)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF Trypsin_2
Other DBs
NCBI-GeneID: 715
NCBI-ProteinID: NP_001724
OMIM: 613785
HGNC: 1246
Ensembl: ENSG00000159403
Vega: OTTHUMG00000168149
Pharos: P00736(Tclin)
UniProt: P00736
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 705 aa
MWLLYLLVPALFCRAGGSIPIPQKLFGEVTSPLFPKPYPNNFETTTVITVPTGYRVKLVF
QQFDLEPSEGCFYDYVKISADKKSLGRFCGQLGSPLGNPPGKKEFMSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASRSKSGEEDPQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEASGYISSLEYPRSYPPDLRCNYSIRVERGLTLHLKFLEPF
DIDDHQQVHCPYDQLQIYANGKNIGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKL
RYTTEIIKCPQPKTLDEFTIIQNLQPQYQFRDYFIATCKQGYQLIEGNQVLHSFTAVCQD
DGTWHRAMPRCKIKDCGQPRNLPNGDFRYTTTMGVNTYKARIQYYCHEPYYKMQTRAGSR
ESEQGVYTCTAQGIWKNEQKGEKIPRCLPVCGKPVNPVEQRQRIIGGQKAKMGNFPWQVF
TNIHGRGGGALLGDRWILTAAHTLYPKEHEAQSNASLDVFLGHTNVEELMKLGNHPIRRV
SVHPDYRQDESYNFEGDIALLELENSVTLGPNLLPICLPDNDTFYDLGLMGYVSGFGVME
EKIAHDLRFVRLPVANPQACENWLRGKNRMDVFSQNMFCAGHPSLKQDACQGDSGGVFAV
RDPNTDRWVATGIVSWGIGCSRGYGFYTKVLNYVDWIKKEMEEED
NT seq 2118 nt   +upstreamnt  +downstreamnt
atgtggctcttgtacctcctggtgccggccctgttctgcagggcaggaggctccattccc
atccctcagaagttatttggggaggtgacttcccctctgttccccaagccttaccccaac
aactttgaaacaaccactgtgatcacagtccccacgggatacagggtgaagctcgtcttc
cagcagtttgacctggagccttctgaaggctgcttctatgattatgtcaagatctctgct
gataagaaaagcctggggaggttctgtgggcaactgggttctccactgggcaaccccccg
ggaaagaaggaatttatgtcccaagggaacaagatgctgctgaccttccacacagacttc
tccaacgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaagct
gtggaccttgatgaatgtgcttcccggagcaaatcaggggaggaggatccccagccccag
tgccagcacctgtgtcacaactacgttggaggctacttctgttcctgccgtccaggctat
gagcttcaggaagacaggcattcctgccaggctgagtgcagcagcgagctgtacacggag
gcatcaggctacatctccagcctggagtaccctcggtcctacccccctgacctgcgctgc
aactacagcatccgggtggagcggggcctcaccctgcacctcaagttcctggagcctttt
gatattgatgaccaccagcaagtacactgcccctatgaccagctacagatctatgccaac
gggaagaacattggcgagttctgtgggaagcaaaggccccccgacctcgacaccagcagc
aatgctgtggatctgctgttcttcacagatgagtcgggggacagccggggctggaagctg
cgctacaccaccgagatcatcaagtgcccccagcccaagaccctagacgagttcaccatc
atccagaacctgcagcctcagtaccagttccgtgactacttcattgctacctgcaagcaa
ggctaccagctcatagaggggaaccaggtgctgcattccttcacagctgtctgccaggat
gatggcacgtggcatcgtgccatgcccagatgcaagatcaaggactgtgggcagccccga
aacctgcctaatggtgacttccgttacaccaccacaatgggagtgaacacctacaaggcc
cgtatccagtactactgccatgagccatattacaagatgcagaccagagctggcagcagg
gagtctgagcaaggggtgtacacctgcacagcacagggcatttggaagaatgaacagaag
ggagagaagattcctcggtgcttgccagtgtgtgggaagcccgtgaaccccgtggaacag
aggcagcgcatcatcggagggcaaaaagccaagatgggcaacttcccctggcaggtgttc
accaacatccacgggcgcgggggcggggccctgctgggcgaccgctggatcctcacagct
gcccacaccctgtatcccaaggaacacgaagcgcaaagcaacgcctctttggatgtgttc
ctgggccacacaaatgtggaagagctcatgaagctaggaaatcaccccatccgcagggtc
agcgtccacccggactaccgtcaggatgagtcctacaattttgagggggacatcgccctg
ctggagctggaaaatagtgtcaccctgggtcccaacctcctccccatctgcctccctgac
aacgataccttctacgacctgggcttgatgggctatgtcagtggcttcggggtcatggag
gagaagattgctcatgacctcaggtttgtccgtctgcccgtagctaatccacaggcctgt
gagaactggctccggggaaagaataggatggatgtgttctctcaaaacatgttctgtgct
ggacacccatctctaaagcaggacgcctgccagggggatagtgggggcgtttttgcagta
agggacccgaacactgatcgctgggtggccacgggcatcgtgtcctggggcatcgggtgc
agcaggggctatggcttctacaccaaagtgctcaactacgtggactggatcaagaaagag
atggaggaggaggactga

KEGG   Homo sapiens (human): 716
Entry
716               CDS       T01001                                 

Symbol
C1S, EDSPD2
Name
(RefSeq) complement C1s
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05133  Pertussis
hsa05150  Staphylococcus aureus infection
hsa05171  Coronavirus disease - COVID-19
hsa05322  Systemic lupus erythematosus
Network
nt06136  Complement activation (viruses)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
  Element
N01313  Classical pathway of complement activation
N01314  SARS-CoV-2 S to classical pathway of complement activation
Disease
H00102  Classic complement pathway component defects
H02240  Ehlers-Danlos syndrome periodontal type
Drug target
Conestat alfa: D10845<US>
Sutimlimab: D11530
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    716 (C1S)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    716 (C1S)
  09171 Infectious disease: bacterial
   05133 Pertussis
    716 (C1S)
   05150 Staphylococcus aureus infection
    716 (C1S)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    716 (C1S)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    716 (C1S)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    716 (C1S)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     716 (C1S)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   716 (C1S)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    716 (C1S)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 hEGF
Other DBs
NCBI-GeneID: 716
NCBI-ProteinID: NP_001725
OMIM: 120580
HGNC: 1247
Ensembl: ENSG00000182326
Vega: OTTHUMG00000150305
Pharos: P09871(Tchem)
UniProt: P09871
LinkDB
Structure
PDB: 

Position
12p13.31
AA seq 688 aa
MWCIVLFSLLAWVYAEPTMYGEILSPNYPQAYPSEVEKSWDIEVPEGYGIHLYFTHLDIE
LSENCAYDSVQIISGDTEEGRLCGQRSSNNPHSPIVEEFQVPYNKLQVIFKSDFSNEERF
TGFAAYYVATDINECTDFVDVPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVNCSGDVF
TALIGEIASPNYPKPYPENSRCEYQIRLEKGFQVVVTLRREDFDVEAADSAGNCLDSLVF
VAGDRQFGPYCGHGFPGPLNIETKSNALDIIFQTDLTGQKKGWKLRYHGDPMPCPKEDTP
NSVWEPAKAKYVFRDVVQITCLDGFEVVEGRVGATSFYSTCQSNGKWSNSKLKCQPVDCG
IPESIENGKVEDPESTLFGSVIRYTCEEPYYYMENGGGGEYHCAGNGSWVNEVLGPELPK
CVPVCGVPREPFEEKQRIIGGSDADIKNFPWQVFFDNPWAGGALINEYWVLTAAHVVEGN
REPTMYVGSTSVQTSRLAKSKMLTPEHVFIHPGWKLLEVPEGRTNFDNDIALVRLKDPVK
MGPTVSPICLPGTSSDYNLMDGDLGLISGWGRTEKRDRAVRLKAARLPVAPLRKCKEVKV
EKPTADAEAYVFTPNMICAGGEKGMDSCKGDSGGAFAVQDPNDKTKFYAAGLVSWGPQCG
TYGLYTRVKNYVDWIMKTMQENSTPRED
NT seq 2067 nt   +upstreamnt  +downstreamnt
atgtggtgcattgtcctgttttcacttttggcatgggtttatgctgagcctaccatgtat
ggggagatcctgtcccctaactatcctcaggcatatcccagtgaggtagagaaatcttgg
gacatagaagttcctgaagggtatgggattcacctctacttcacccatctggacattgag
ctgtcagagaactgtgcgtatgactcagtgcagataatctcaggagacactgaagaaggg
aggctctgtggacagaggagcagtaacaatccccactctccaattgtggaagagttccaa
gtcccatacaacaaactccaggtgatctttaagtcagacttttccaatgaagagcgtttt
acggggtttgctgcatactatgttgccacagacataaatgaatgcacagattttgtagat
gtcccttgtagccacttctgcaacaatttcattggtggttacttctgctcctgccccccg
gaatatttcctccatgatgacatgaagaattgcggagttaattgcagtggggatgtattc
actgcactgattggggagattgcaagtcccaattatcccaaaccatatccagagaactca
aggtgtgaataccagatccggttggagaaagggttccaagtggtggtgaccttgcggaga
gaagattttgatgtggaagcagctgactcagcgggaaactgccttgacagtttagttttt
gttgcaggagatcggcaatttggtccttactgtggtcatggattccctgggcctctaaat
attgaaaccaagagtaatgctcttgatatcatcttccaaactgatctaacagggcaaaaa
aagggctggaaacttcgctatcatggagatccaatgccctgccctaaggaagacactccc
aattctgtttgggagcctgcgaaggcaaaatatgtctttagagatgtggtgcagataacc
tgtctggatgggtttgaagttgtggagggacgtgttggtgcaacatctttctattcgact
tgtcaaagcaatggaaagtggagtaattccaaactgaaatgtcaacctgtggactgtggc
attcctgaatccattgagaatggtaaagttgaagacccagagagcactttgtttggttct
gtcatccgctacacttgtgaggagccatattactacatggaaaatggaggaggtggggag
tatcactgtgctggtaacgggagctgggtgaatgaggtgctgggcccggagctgccgaaa
tgtgttccagtctgtggagtccccagagaaccctttgaagaaaaacagaggataattgga
ggatccgatgcagatattaaaaacttcccctggcaagtcttctttgacaacccatgggct
ggtggagcgctcattaatgagtactgggtgctgacggctgctcatgttgtggagggaaac
agggagccaacaatgtatgttgggtccacctcagtgcagacctcacggctggcaaaatcc
aagatgctcactcctgagcatgtgtttattcatccgggatggaagctgctggaagtccca
gaaggacgaaccaattttgataatgacattgcactggtgcggctgaaagacccagtgaaa
atgggacccaccgtctctcccatctgcctaccaggcacctcttccgactacaacctcatg
gatggggacctgggactgatctcaggctggggccgaacagagaagagagatcgtgctgtt
cgcctcaaggcggcaaggttacctgtagctcctttaagaaaatgcaaagaagtgaaagtg
gagaaacccacagcagatgcagaggcctatgttttcactcctaacatgatctgtgctgga
ggagagaagggcatggatagctgtaaaggggacagtggtggggcctttgctgtacaggat
cccaatgacaagaccaaattctacgcagctggcctggtgtcctgggggccccagtgtggg
acctatgggctctacacacgggtaaagaactatgttgactggataatgaagactatgcag
gaaaatagcaccccccgtgaggactaa

DBGET integrated database retrieval system