KEGG   Homo sapiens (human): 87
Entry
87                CDS       T01001                                 
Symbol
ACTN1, BDPLT15
Name
(RefSeq) actinin alpha 1
  KO
K05699  actinin alpha 1/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05146  Amoebiasis
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01082  Shigella IpaA to ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H01235  Bleeding disorder platelet-type
H01740  Macrothrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    87 (ACTN1)
   04520 Adherens junction
    87 (ACTN1)
   04530 Tight junction
    87 (ACTN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    87 (ACTN1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    87 (ACTN1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    87 (ACTN1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    87 (ACTN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    87 (ACTN1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    87 (ACTN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    87 (ACTN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    87 (ACTN1)
   04147 Exosome [BR:hsa04147]
    87 (ACTN1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    87 (ACTN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     87 (ACTN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   87 (ACTN1)
  Exosomal proteins of colorectal cancer cells
   87 (ACTN1)
  Exosomal proteins of bladder cancer cells
   87 (ACTN1)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 EF-hand_7 CAMSAP_CH EF-hand_8 EF-hand_5 XisI
Other DBs
NCBI-GeneID: 87
NCBI-ProteinID: NP_001093
OMIM: 102575
HGNC: 163
Ensembl: ENSG00000072110
Pharos: P12814(Tbio)
UniProt: P12814 A0A024R694
Structure
LinkDB
Position
14:complement(68874128..68979302)
AA seq 892 aa
MDHYDSQQTNDYMQPEEDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFR
DGLKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNV
KMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFC
ALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMT
YVSSFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENR
VPENTMHAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRM
VSDINNAWGCLEQVEKGYEEWLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQK
DYETATLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKIC
DQWDNLGALTQKRREALERTEKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHT
IEEIQGLTTAHEQFKATLPDADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEI
NGKWDHVRQLVPRRDQALTEEHARQQHNERLRKQFGAQANVIGPWIQTKMEEIGRISIEM
HGTLEDQLSHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQL
LTTIARTINEVENQILTRDAKGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGY
DIGNDPQGEAEFARIMSIVDPNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDK
NYITMDELRRELPPDQAEYCIARMAPYTGPDSVPGALDYMSFSTALYGESDL
NT seq 2679 nt   +upstreamnt  +downstreamnt
atggaccattatgattctcagcaaaccaacgattacatgcagccagaagaggactgggac
cgggacctgctcctggacccggcctgggagaagcagcagagaaagacattcacggcatgg
tgtaactcccacctccggaaggcggggacacagatcgagaacatcgaagaggacttccgg
gatggcctgaagctcatgctgctgctggaggtcatctcaggtgaacgcttggccaagcca
gagcgaggcaagatgagagtgcacaagatctccaacgtcaacaaggccctggatttcata
gccagcaaaggcgtcaaactggtgtccatcggagccgaagaaatcgtggatgggaatgtg
aagatgaccctgggcatgatctggaccatcatcctgcgctttgccatccaggacatctcc
gtggaagagacttcagccaaggaagggctgctcctgtggtgtcagagaaagacagcccct
tacaaaaatgtcaacatccagaacttccacataagctggaaggatggcctcggcttctgt
gctttgatccaccgacaccggcccgagctgattgactacgggaagctgcggaaggatgat
ccactcacaaatctgaatacggcttttgacgtggcagagaagtacctggacatccccaag
atgctggatgccgaagacatcgttggaactgcccgaccggatgagaaagccatcatgact
tacgtgtctagcttctaccacgccttctctggagcccagaaggcggagacagcagccaat
cgcatctgcaaggtgttggccgtcaaccaggagaacgagcagcttatggaagactacgag
aagctggccagtgatctgttggagtggatccgccgcacaatcccgtggctggagaaccgg
gtgcccgagaacaccatgcatgccatgcaacagaagctggaggacttccgggactaccgg
cgcctgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacg
ctgcagaccaagctgcggctcagcaaccggcctgccttcatgccctctgagggcaggatg
gtctcggacatcaacaatgcctggggctgcctggagcaggtggagaagggctatgaggag
tggttgctgaatgagatccggaggctggagcgactggaccacctggcagagaagttccgg
cagaaggcctccatccacgaggcctggactgacggcaaagaggccatgctgcgacagaag
gactatgagaccgccaccctctcggagatcaaggccctgctcaagaagcatgaggccttc
gagagtgacctggctgcccaccaggaccgtgtggagcagattgccgccatcgcacaggag
ctcaatgagctggactattatgactcacccagtgtcaacgcccgttgccaaaagatctgt
gaccagtgggacaatctgggggccctaactcagaagcgaagggaagctctggagcggacc
gagaaactgctggagaccattgaccagctgtacttggagtatgccaagcgggctgcaccc
ttcaacaactggatggagggggccatggaggacctgcaggacaccttcattgtgcacacc
attgaggagatccagggactgaccacagcccatgagcagttcaaggccaccctccctgat
gccgacaaggagcgcctggccatcctgggcatccacaatgaggtgtccaagattgtccag
acctaccacgtcaatatggcgggcaccaacccctacacaaccatcacgcctcaggagatc
aatggcaaatgggaccacgtgcggcagctggtgcctcggagggaccaagctctgacggag
gagcatgcccgacagcagcacaatgagaggctacgcaagcagtttggagcccaggccaat
gtcatcgggccctggatccagaccaagatggaggagatcgggaggatctccattgagatg
catgggaccctggaggaccagctcagccacctgcggcagtatgagaagagcatcgtcaac
tacaagccaaagattgatcagctggagggcgaccaccagctcatccaggaggcgctcatc
ttcgacaacaagcacaccaactacaccatggagcacatccgtgtgggctgggagcagctg
ctcaccaccatcgccaggaccatcaatgaggtagagaaccagatcctgacccgggatgcc
aagggcatcagccaggagcagatgaatgagttccgggcctccttcaaccactttgaccgg
gatcactccggcacactgggtcccgaggagttcaaagcctgcctcatcagcttgggttat
gatattggcaacgacccccagggagaagcagaatttgcccgcatcatgagcattgtggac
cccaaccgcctgggggtagtgacattccaggccttcattgacttcatgtcccgcgagaca
gccgacacagatacagcagaccaagtcatggcttccttcaagatcctggctggggacaag
aactacattaccatggacgagctgcgccgcgagctgccacccgaccaggctgagtactgc
atcgcgcggatggccccctacaccggccccgactccgtgccaggtgctctggactacatg
tccttctccacggcgctgtacggcgagagtgacctctaa

KEGG   Homo sapiens (human): 81
Entry
81                CDS       T01001                                 
Symbol
ACTN4, ACTININ-4, FSGS, FSGS1
Name
(RefSeq) actinin alpha 4
  KO
K05699  actinin alpha 1/4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05146  Amoebiasis
hsa05203  Viral carcinogenesis
hsa05322  Systemic lupus erythematosus
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01082  Shigella IpaA to ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H00626  Focal segmental glomerulosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    81 (ACTN4)
   04520 Adherens junction
    81 (ACTN4)
   04530 Tight junction
    81 (ACTN4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    81 (ACTN4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    81 (ACTN4)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    81 (ACTN4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    81 (ACTN4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    81 (ACTN4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    81 (ACTN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    81 (ACTN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    81 (ACTN4)
   04147 Exosome [BR:hsa04147]
    81 (ACTN4)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    81 (ACTN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     81 (ACTN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81 (ACTN4)
  Exosomal proteins of colorectal cancer cells
   81 (ACTN4)
  Exosomal proteins of bladder cancer cells
   81 (ACTN4)
SSDB
Motif
Pfam: Spectrin CH EFhand_Ca_insen EF-hand_1 EF-hand_6 CAMSAP_CH EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 81
NCBI-ProteinID: NP_004915
OMIM: 604638
HGNC: 166
Ensembl: ENSG00000130402
Pharos: O43707(Tbio)
UniProt: O43707 A0A0S2Z3G9
Structure
LinkDB
Position
19:38647649..38731589
AA seq 911 aa
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
NT seq 2736 nt   +upstreamnt  +downstreamnt
atggtggactaccacgcggcgaaccagtcgtaccagtacggccccagcagcgcgggcaat
ggcgctggcggcgggggcagcatgggcgactacatggcccaggaggacgactgggaccgg
gacctgctgctggacccggcctgggagaagcagcagcgcaagaccttcacggcatggtgc
aactcccacctgcggaaggcaggcacacagatcgagaacattgatgaggacttccgagac
gggctcaagctcatgctgctcctggaggtcatatcaggggagcggttacctaagccggag
cgggggaagatgagagtgcacaaaatcaacaatgtgaacaaagcgctggactttattgcc
agcaaaggcgtcaagctggtctccatcggggcagaagagattgtggacggcaacgcaaag
atgaccctgggaatgatctggaccatcatccttaggttcgccatccaggacatctccgtg
gaagagacctcggccaaggaagggctccttctctggtgccagagaaagacagccccgtat
aagaacgtcaatgtgcagaacttccacatcagctggaaggatggtcttgccttcaatgcc
ctgatccaccggcacagaccagagctgattgagtatgacaagctgaggaaggacgaccct
gtcaccaacctgaacaatgccttcgaagtggctgagaaatacctcgacatccccaagatg
ctggatgcagaggacatcgtgaacacggcccggcccgacgagaaggccataatgacctat
gtgtccagcttctaccatgccttttcaggagcgcagaaggctgaaactgccgccaaccgg
atctgtaaggtgctggctgtcaaccaagagaacgagcacctgatggaggactacgagaag
ctggccagcgacctcctggagtggatccggcgcaccatcccctggctggaggaccgtgtg
ccccaaaagactatccaggagatgcagcagaagctggaggacttccgcgactaccggcgt
gtgcacaagccgcccaaggtgcaggagaagtgccagctggagatcaacttcaacacgctg
cagaccaagctgcgcctcagcaaccggcccgccttcatgccctccgagggcaagatggtc
tcggacatcaacaatggctggcagcacttggagcaggctgagaagggctacgaggagtgg
ctgctgaatgagatccgcaggctggagcggctcgaccacctggcagagaagttccggcag
aaggcctccatccacgaggcctggactgacgggaaggaagccatgctgaagcaccgggac
tacgagacggccacactatcggacatcaaagccctcattcgcaagcacgaggccttcgag
agcgacctggctgcgcaccaggaccgcgtggagcagatcgccgccattgcccaggagctc
aacgagctggattactacgactcccacaatgtcaacacccggtgccagaagatctgtgac
cagtgggacgccctcggctctctgacacatagtcgcagggaagccctggagaaaacagag
aagcagctggaggccatcgaccagctgcacctggaatacgccaagcgcgcggcccccttc
aacaactggatggagagcgccatggaggacctccaggacatgttcatcgtccataccatc
gaggagattgagggcctgatctcagcccatgaccagttcaagtccaccctgccggacgcc
gatagggagcgcgaggccatcctggccatccacaaggaggcccagaggatcgctgagagc
aaccacatcaagctgtcgggcagcaacccctacaccaccgtcaccccgcaaatcatcaac
tccaagtgggagaaggtgcagcagctggtgccaaaacgggaccatgccctcctggaggag
cagagcaagcagcagtccaacgagcacctgcgccgccagttcgccagccaggccaatgtt
gtggggccctggatccagaccaagatggaggagatcgggcgcatctccattgagatgaac
gggaccctggaggaccagctgagccacctgaagcagtatgaacgcagcatcgtggactac
aagcccaacctggacctgctggagcagcagcaccagctcatccaggaggccctcatcttc
gacaacaagcacaccaactataccatggagcacatccgcgtgggctgggagcagctgctc
accaccattgcccgcaccatcaacgaggtggagaaccagatcctcacccgcgacgccaag
ggcatcagccaggagcagatgcaggagttccgggcgtccttcaaccacttcgacaaggat
catggcggggcgctggggcccgaggagttcaaggcctgcctcatcagcctgggctacgac
gtggagaacgaccggcagggtgaggccgagttcaaccgcatcatgagcctggtcgacccc
aaccatagcggccttgtgaccttccaagccttcatcgacttcatgtcgcgggagaccacc
gacacggacacggctgaccaggtcatcgcttccttcaaggtcttagcaggggacaagaac
ttcatcacagctgaggagctgcggagagagctgccccccgaccaggccgagtactgcatc
gcccgcatggcgccataccagggccctgacgccgtgcccggtgccctcgactacaagtcc
ttctccacggccttgtatggcgagagcgacctgtga

KEGG   Homo sapiens (human): 7414
Entry
7414              CDS       T01001                                 
Symbol
VCL, CMD1W, CMH15, HEL114, MV, MVCL
Name
(RefSeq) vinculin
  KO
K05700  vinculin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05146  Amoebiasis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01082  Shigella IpaA to ITGA/B-TALIN/VINCULIN signaling pathway
Disease
H00292  Hypertrophic cardiomyopathy
H00294  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7414 (VCL)
   04520 Adherens junction
    7414 (VCL)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7414 (VCL)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7414 (VCL)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    7414 (VCL)
   05100 Bacterial invasion of epithelial cells
    7414 (VCL)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7414 (VCL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7414 (VCL)
   04147 Exosome [BR:hsa04147]
    7414 (VCL)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     7414 (VCL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7414 (VCL)
SSDB
Motif
Pfam: Vinculin VMAP-M0 CARD
Other DBs
NCBI-GeneID: 7414
NCBI-ProteinID: NP_054706
OMIM: 193065
HGNC: 12665
Ensembl: ENSG00000035403
Pharos: P18206(Tbio)
UniProt: P18206 V9HWK2 B3KXA2
Structure
LinkDB
Position
10:73998116..74121363
AA seq 1134 aa
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ
PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK
DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ
NT seq 3405 nt   +upstreamnt  +downstreamnt
atgccagtgtttcatacgcgcacgatcgagagcatcctggagccggtggcacagcagatc
tcccacctggtgataatgcacgaggagggcgaggtggacggcaaagccattcctgacctc
accgcgcccgtggccgccgtgcaggcggccgtcagcaacctcgtccgggttggaaaagag
actgttcaaaccactgaggatcagattttgaagagagatatgccaccagcatttattaag
gttgagaatgcttgcaccaagcttgtccaggcagctcagatgcttcagtcagacccttac
tcagtgcctgctcgagattatctaattgatgggtcaaggggcatcctctctggaacatca
gacctgctccttaccttcgatgaggctgaggtccgtaaaattattagagtttgcaaagga
attttggaatatcttacagtggcagaggtggtggagactatggaagatttggtcacttac
acaaagaatcttgggccaggaatgactaagatggccaagatgattgacgagagacagcag
gagctcactcaccaggagcaccgagtgatgttggtgaactcgatgaacaccgtgaaagag
ttgctgccagttctcatttcagctatgaagatttttgtaacaactaaaaactcaaaaaac
caaggcatagaggaagctttaaaaaatcgcaattttactgtagaaaaaatgagtgctgaa
attaatgagataattcgtgtgttacaactcacctcttgggatgaagatgcctgggccagc
aaggacactgaagccatgaagagagcattggcctccatagactccaaactgaaccaggcc
aaaggttggctccgtgaccctagtgcctccccaggggatgctggtgagcaggccatcaga
cagatcttagatgaagctggaaaagttggtgaactctgtgcaggcaaagaacgcagggag
attctgggaacttgcaaaatgctagggcagatgactgatcaagtggctgacctccgtgcc
agaggacaaggatcctcaccggtggccatgcagaaagctcagcaggtatctcagggtctg
gatgtgctcacagcaaaagtggaaaatgcagctcgcaagctggaagccatgaccaactca
aagcagagcattgcaaagaagatcgatgctgctcagaactggcttgcagatccaaatggt
ggaccggaaggagaagagcagattcgaggtgctttggctgaagctcggaaaatagcagaa
ttatgtgatgatcctaaagaaagagatgacattctacgttcccttggggaaatatctgct
ctgacttctaaattagcagatctacgaagacaggggaaaggagattctccagaggctcga
gccttggccaaacaggtggccacggccctgcagaacctgcagaccaaaaccaaccgggct
gtggccaacagcagaccggccaaagcagctgtacaccttgagggcaagattgagcaagca
cagcggtggattgataatcccacagtggatgaccgtggagtcggtcaggctgccatccgg
gggcttgtggccgaagggcatcgtctggctaatgttatgatggggccttatcggcaagat
cttctcgccaagtgtgaccgagtggaccagctgacagcccagctggctgacctggctgcc
agaggggaaggggagagtcctcaggcacgagcacttgcatctcagctccaagactcctta
aaggatctaaaagctcggatgcaggaggccatgactcaggaagtgtcagatgttttcagc
gataccacaactcccatcaagctgttggcagtggcagccacggcgcctcctgatgcgcct
aacagggaagaggtatttgatgagagggcagctaactttgaaaaccattcaggaaagctt
ggtgctacggccgagaaggcggctgcggttggtactgctaataaatcaacagtggaaggc
attcaggcctcagtgaagacggcccgagaactcacaccccaggtggtctcggctgctcgt
atcttacttaggaaccctggaaatcaagctgcttatgaacattttgagaccatgaagaac
cagtggatcgataatgttgaaaaaatgacagggctggtggacgaagccattgataccaaa
tctctgttggatgcttcagaagaagcaattaaaaaagacctggacaagtgcaaggtagct
atggccaacattcagcctcagatgctggttgctggggcaaccagtattgctcgtcgggcc
aaccggatcctgctggtggctaagagggaggtggagaattccgaggatcccaagttccgt
gaggctgtgaaagctgcctctgatgaattgagcaaaaccatctccccgatggtgatggat
gcaaaagctgtggctggaaacatttccgaccctggactgcaaaagagcttcctggactca
ggatatcggatcctgggagctgtggccaaggtcagagaagccttccaacctcaggagcct
gacttcccgccgcctccaccagaccttgaacaactccgactaacagatgagcttgctcct
cccaaaccacctctgcctgaaggtgaggtccctccacctaggcctccaccaccagaggaa
aaggatgaagagttccctgagcagaaggccggggaggtgattaaccagccaatgatgatg
gctgccagacagctccatgatgaagctcgcaaatggtccagcaagccgggcatcccagcc
gctgaggtgggtataggtgttgtagctgaggcagatgcggccgatgctgctggcttccct
gtcccccctgacatggaagacgattacgaacctgagctgctgttaatgccatccaatcag
ccggtcaaccagcccattctggccgcggctcagtccttgcatcgggaagctaccaagtgg
tctagtaagggcaatgacatcattgcagcagccaagcgcatggctctgctgatggctgag
atgtctcggctggtaagagggggcagtggtaccaagcgggcactcattcagtgtgccaag
gacatcgccaaggcctcagatgaggtgactcggttggccaaggaggttgccaagcagtgc
acagataaacggattagaaccaacctcttacaggtatgtgagcgaatcccaaccataagc
acccagctcaaaatcctgtccacagtgaaggccaccatgctgggccggaccaacatcagt
gatgaggagtctgagcaggccacagagatgctggttcacaatgcccagaacctcatgcag
tctgtgaaggagactgtgcgggaagctgaagctgcttcaatcaaaattcgaacagatgct
ggatttacactgcgctgggttagaaagactccctggtaccagtag

DBGET integrated database retrieval system