KEGG   Homo sapiens (human): 200909Help
Entry
200909            CDS       T01001                                 

Gene name
HTR3D, 5HT3D
Definition
(RefSeq) 5-hydroxytryptamine receptor 3D
  KO
K04819  5-hydroxytryptamine receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Alosetron (DG00046): D02829 D07129
Azasetron (DG01521): D01613 D07481
Batanopride hydrochloride: D03060
Bemesetron: D03073
Cilansetron (DG00047): D03495 D03496
Clozapine: D00283
Dazopride fumarate: D03662
Dolasetron (DG00063): D00725 D07867
Fabesetron hydrochloride: D01838
Galdansetron hydrochloride: D04294
Indisetron hydrochloride: D02632
Itasetron (DG01240): D04642 D09749
Lurosetron mesylate: D04821
Mirisetron maleate: D05050
Mirtazapine (DG02838): D00563 D11056
Ondansetron (DG00060): D00456 D00678
Palonosetron (DG00064): D05343 D07175
Pancopride: D05348
Quipazine maleate: D05685
Ramosetron (DG01239): D02016 D08466
Renzapride: D06396
Tedatioxetine (DG01311): D10170 D10171
Tropanserin hydrochloride: D06253
Tropisetron (DG00062): D02041 D02130
Vortioxetine (DG00965): D10184 D10185
Zacopride hydrochloride: D06353
Zatosetron maleate: D06358
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    200909 (HTR3D)
  09157 Sensory system
   04742 Taste transduction
    200909 (HTR3D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    200909 (HTR3D)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Serotonin (5-HT3)
   200909 (HTR3D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 200909
NCBI-ProteinID: NP_001157118
OMIM: 610122
HGNC: 24004
Ensembl: ENSG00000186090
Vega: OTTHUMG00000156858
Pharos: Q70Z44(Tchem)
UniProt: Q70Z44
LinkDB All DBs
Position
3q27.1
AA seq 454 aa AA seqDB search
MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQHRVDPAAFQAVFDRKAIGPVTNYS
VATHVNISFTLSAIWNCYSRIHTFNCHHARPWHNQFVQWNPDECGGIKKSGMATENLWLS
DVFIEESVDQTPAGLMASMSIVKATSNTISQCGWSASANWTPSISPSMDRARAWRRMSRS
FQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFHVAIRRRCRPSPYVVNFLVPS
GILIAIDALSFYLPLESGNCAPFKMTVLLGYSVFLLMMNDLLPATSTSSHASLVAPLALM
QTPLPAGVYFALCLSLMVGSLLETIFITHLLHVATTQPLPLPRWLHSLLLHCTGQGRCCP
TAPQKGNKGPGLTPTHLPGVKEPEVSAGQMPGPGEAELTGGSEWTRAQREHEAQKQHSVE
LWVQFSHAMDALLFRLYLLFMASSIITVICLWNT
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaacactctccaggccccccagccctggccctcctctctcagtctctgctcact
acaggaaatggcgacactttgattatcaattgcccaggctttggccagcacagggtggac
cctgcagcctttcaagcagtgtttgacagaaaggctattggtccagtcaccaactacagt
gtcgccactcatgtcaacatctccttcaccttgtctgccatctggaactgctattccagg
attcacaccttcaactgccaccatgcccggccttggcacaatcaatttgtgcagtggaac
ccagatgaatgcggaggcatcaagaagtccggcatggcaactgagaacctatggctttca
gatgtcttcatcgaggagtctgtggatcagacacctgcaggtctcatggctagtatgtca
atagtgaaggccacatcaaacacaataagccaatgtgggtggtcagcatctgcaaactgg
acaccttctatttccccttccatggacagagcccgggcatggagaaggatgtccaggagc
tttcaaatacatcacagaacctcattcagaacaaggagggagtgggtactgctgggtatc
caaaaaagaacaataaaggtgaccgtggccactaaccagtatgaacaagccatcttccat
gtggccatcaggcgcaggtgcaggcccagcccctacgtggtaaactttctggtgcccagt
ggcattctgattgccatcgatgccctcagtttctacctgccactggaaagtgggaattgt
gccccattcaagatgactgttctgctgggctacagcgtcttcctgctcatgatgaatgac
ttgctcccagccactagcacttcatcacatgcttcactagtggcgcctctggccctcatg
cagacccccttgcctgcaggtgtctacttcgccctgtgcctgtccctgatggtgggcagc
ctgctggagaccatcttcatcacccacctgctgcacgtggccaccacccagcccctacct
ctgcctcggtggctccactccctgctgctgcactgcaccggccaagggagatgctgtccc
actgcgccccagaagggaaataagggcccgggtctcacccccacccacctgcccggtgtg
aaggagccagaggtatcagcagggcagatgccaggccctggggaggcagagctgacaggg
ggctcagaatggacaagggcccagcgggaacacgaggcccagaagcagcactcggtggag
ctgtgggtgcagttcagccacgcgatggacgccctgctcttccgcctctacctgctcttc
atggcctcctccatcatcaccgtcatatgcctctggaacacctag

DBGET integrated database retrieval system