KEGG   Homo sapiens (human): 23291
Entry
23291             CDS       T01001                                 
Symbol
FBXW11, BTRC2, BTRCP2, FBW1B, FBXW1B, Fbw11, Hos, NEDJED
Name
(RefSeq) F-box and WD repeat domain containing 11
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04710  Circadian rhythm
hsa05131  Shigellosis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06516  TNF signaling
  Element
N00942  Shigella OspG to TNF-NFKB signaling pathway
Disease
H02460  Neurodevelopmental disorder with dysmorphic facies and skeletal anomalies
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    23291 (FBXW11)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    23291 (FBXW11)
   04340 Hedgehog signaling pathway
    23291 (FBXW11)
   04390 Hippo signaling pathway
    23291 (FBXW11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    23291 (FBXW11)
   04218 Cellular senescence
    23291 (FBXW11)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    23291 (FBXW11)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    23291 (FBXW11)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    23291 (FBXW11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    23291 (FBXW11)
   03036 Chromosome and associated proteins [BR:hsa03036]
    23291 (FBXW11)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     23291 (FBXW11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     23291 (FBXW11)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D ANAPC4_WD40 F-box-like NBCH_WD40 WD40_like F-box Nup160 Frtz DUF1513 WD40_2 DUF4508 DUF6188
Other DBs
NCBI-GeneID: 23291
NCBI-ProteinID: NP_036432
OMIM: 605651
HGNC: 13607
Ensembl: ENSG00000072803
Pharos: Q9UKB1(Tbio)
UniProt: Q9UKB1
Structure
LinkDB
Position
5:complement(171861549..172006638)
AA seq 542 aa
MEPDSVIEDKTIELMCSVPRSLWLGCANLVESMCALSCLQSMPSVRCLQISNGTSSVIVS
RKRPSEGNYQKEKDLCIKYFDQWSESDQVEFVEHLISRMCHYQHGHINSYLKPMLQRDFI
TALPEQGLDHIAENILSYLDARSLCAAELVCKEWQRVISEGMLWKKLIERMVRTDPLWKG
LSERRGWDQYLFKNRPTDGPPNSFYRSLYPKIIQDIETIESNWRCGRHNLQRIQCRSENS
KGVYCLQYDDEKIISGLRDNSIKIWDKTSLECLKVLTGHTGSVLCLQYDERVIVTGSSDS
TVRVWDVNTGEVLNTLIHHNEAVLHLRFSNGLMVTCSKDRSIAVWDMASATDITLRRVLV
GHRAAVNVVDFDDKYIVSASGDRTIKVWSTSTCEFVRTLNGHKRGIACLQYRDRLVVSGS
SDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLQAALDPRAPA
STLCLRTLVEHSGRVFRLQFDEFQIISSSHDDTILIWDFLNVPPSAQNETRSPSRTYTYI
SR
NT seq 1629 nt   +upstreamnt  +downstreamnt
atggagcccgactcggtgattgaggacaagaccatcgagctcatgtgttctgtgccaagg
tctttgtggctaggctgcgccaacctggtagagagcatgtgcgcactgagttgcctgcag
agcatgcccagtgtcagatgtctccagataagtaatggaacatcatctgtgatcgtctcc
agaaagaggccatcagaaggaaactatcaaaaagaaaaagacttgtgtattaaatatttt
gaccagtggtctgaatcagatcaagtggaatttgtggaacatcttatttcacgaatgtgt
cattatcagcatggacatattaactcttacctgaagcccatgttgcagcgggactttatt
accgctttaccagagcaaggcttagatcacatagcagaaaacattctttcgtacctggat
gccaggtctctgtgtgcagcagagctggtatgtaaagaatggcagcgagtgatctcagaa
ggaatgctttggaagaagctgattgaacgaatggtacgcactgatcccctatggaaagga
ctttcagaaagaagagggtgggatcagtacctgtttaaaaacagacccacagatggccct
ccaaattcattttataggtcattatacccaaagattatccaggatatagagactatagaa
tctaactggcggtgtggacgacacaacttgcagaggattcagtgccgctctgaaaatagt
aaaggtgtctactgtttacagtacgatgatgaaaaaattatcagtggcctacgagataat
tctattaagatatgggataaaaccagcctggaatgtttgaaagtgttaacaggacacaca
ggctctgtcctctgtctgcagtatgatgagcgtgtcattgtaactggctcttcagattct
acggtgagagtgtgggatgtgaacacgggtgaagttcttaacacattgatccaccacaat
gaggctgtattgcacttacgcttcagcaatggactgatggtgacctgttccaaggaccgc
tccattgctgtgtgggacatggcttctgcgaccgacatcactttacgccgtgtcctggtt
ggccaccgggctgccgtcaatgtagtagactttgacgacaagtacatcgtgtctgcctct
ggtgacaggaccatcaaagtctggagcacgagcacctgtgaatttgttcgtactctcaat
gggcacaagcggggcattgcctgtctccagtacagggatcgcctggttgttagtggatca
tcagataataccattaggctctgggatattgaatgtggtgcctgtttaagagtcctagag
ggacatgaagaattggtccgatgcatccggtttgataacaagaggattgtcagtggggcc
tatgatgggaaaattaaagtttgggacttgcaagctgctcttgaccctcgagccccagca
agcacattgtgtttgcgcacattggtggaacattctggacgtgtgtttcggctccagttt
gatgagtttcagatcatcagcagctcccatgatgacactattttgatttgggatttctta
aatgtgcctcccagtgcccagaatgagacccgttctccctccagaacatacacttacatc
tctagataa

KEGG   Homo sapiens (human): 26232
Entry
26232             CDS       T01001                                 
Symbol
FBXO2, FBG1, FBX2, Fbs1, NFB42, OCP1
Name
(RefSeq) F-box protein 2
  KO
K10099  F-box protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26232 (FBXO2)
   04120 Ubiquitin mediated proteolysis
    26232 (FBXO2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26232 (FBXO2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    26232 (FBXO2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26232 (FBXO2)
Lectins [BR:hsa04091]
 F-box lectins
  26232 (FBXO2)
SSDB
Motif
Pfam: FBA F-box-like F-box
Other DBs
NCBI-GeneID: 26232
NCBI-ProteinID: NP_036300
OMIM: 607112
HGNC: 13581
Ensembl: ENSG00000116661
Pharos: Q9UK22(Tbio)
UniProt: Q9UK22
LinkDB
Position
1:complement(11648387..11654429)
AA seq 296 aa
MDGDGDPESVGQPEEASPEEQPEEASAEEERPEDQQEEEAAAAAAYLDELPEPLLLRVLA
ALPAAELVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGVEEERDHWQQFYFLSKRR
RNLLRNPCGEEDLEGWCDVEHGGDGWRVEELPGDSGVEFTHDESVKKYFASSFEWCRKAQ
VIDLQAEGYWEELLDTTQPAIVVKDWYSGRSDAGCLYELTVKLLSEHENVLAEFSSGQVA
VPQDSDGGGWMEISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
NT seq 891 nt   +upstreamnt  +downstreamnt
atggacggagacggtgacccagagagcgtgggccagcccgaggaggcaagcccggaggag
cagccagaggaggcgagtgctgaggaggagcggccggaggaccagcaggaggaggaggcg
gcggccgccgccgcgtacctggacgagctgcccgagccgctgctgctgcgcgtgctggcc
gcactgccggccgccgagctggtgcaggcctgccgcctggtgtgcctgcgctggaaggag
ctggtggacggcgccccgctgtggctgctcaagtgccagcaggaggggctggtgcccgag
ggcggcgtggaggaggagcgcgaccactggcagcagttctacttcctgagcaagcggcgc
cgcaaccttctgcgtaacccgtgtggggaagaggacttggaaggctggtgtgacgtggag
catggtggggacggctggagggtggaggagctgcctggagacagtggggtggagttcacc
cacgatgagagcgtcaagaagtacttcgcctcctcctttgagtggtgtcgcaaagcacag
gtcattgacctgcaggctgagggctactgggaggagctgctggacacgactcagccggcc
atcgtggtgaaggactggtactcgggccgcagcgacgctggttgcctctacgagctcacc
gttaagctactgtccgagcacgagaacgtgctggctgagttcagcagcgggcaggtggca
gtgccccaagacagtgacggcgggggctggatggagatctcccacaccttcaccgactac
gggccgggcgtccgcttcgtccgcttcgagcacggggggcaggactccgtctactggaag
ggctggttcggggcccgggtgaccaacagcagcgtgtgggtagaaccctga

KEGG   Homo sapiens (human): 26272
Entry
26272             CDS       T01001                                 
Symbol
FBXO4, FBX4
Name
(RefSeq) F-box protein 4
  KO
K10291  F-box protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    26272 (FBXO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    26272 (FBXO4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     26272 (FBXO4)
SSDB
Motif
Pfam: F-box-like F-box PRANC Arf
Other DBs
NCBI-GeneID: 26272
NCBI-ProteinID: NP_036308
OMIM: 609090
HGNC: 13583
Ensembl: ENSG00000151876
Pharos: Q9UKT5(Tbio)
UniProt: Q9UKT5 B3KNA0
Structure
LinkDB
Position
5:41925281..42040404
AA seq 387 aa
MAGSEPRSGTNSPPPPFSDWGRLEAAILSGWKTFWQSVSKERVARTTSREEVDEAASTLT
RLPIDVQLYILSFLSPHDLCQLGSTNHYWNETVRDPILWRYFLLRDLPSWSSVDWKSLPD
LEILKKPISEVTDGAFFDYMAVYRMCCPYTRRASKSSRPMYGAVTSFLHSLIIQNEPRFA
MFGPGLEELNTSLVLSLMSSEELCPTAGLPQRQIDGIGSGVNFQLNNQHKFNILILYSTT
RKERDRAREEHTSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKR
HEWQDEFSHIMAMTDPAFGSSGRPLLVLSCISQGDVKRMPCFYLAHELHLNLLNHPWLVQ
DTEAETLTGFLNGIEWILEEVESKRAR
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcgggaagcgagccgcgcagcggaacaaactcgccgccgccgcccttcagcgactgg
ggccgcctggaggcggccatcctcagcggctggaagaccttctggcagtcagtgagcaag
gagagggtggcgcgtacgacctcacgggaggaggtggatgaggcggccagcaccctgacg
cggctgccgattgatgtacagctatatattttgtcctttctttcacctcatgatctgtgt
cagttgggaagtacaaatcattattggaatgaaactgtaagagatccaattctgtggaga
tactttttgttgagggatcttccttcttggtcttctgttgactggaagtctcttccagat
ctagaaatcttaaaaaagcctatatctgaggtcactgatggtgcattttttgactacatg
gcagtctatagaatgtgctgtccatacacaagaagagcttcaaaatccagccgtcctatg
tatggagctgtcacttcttttttacactccctgatcattcagaatgaaccacgatttgct
atgtttggaccaggtttggaagaattgaatacctctttggtgttgagcttgatgtcttca
gaggaactttgcccaacagctggtttgcctcagaggcagattgatggtattggatcagga
gtcaattttcagttgaacaaccaacataaattcaacattctaatcttatattcaactacc
agaaaggaaagagatagagcaagggaagagcatacaagtgcagttaacaagatgttcagt
cgacacaatgaaggtgatgatcaacaaggaagccggtacagtgtgattccacagattcaa
aaagtgtgtgaagttgtagatgggttcatctatgttgcaaatgctgaagctcataaaaga
catgaatggcaagatgaattttctcatattatggcaatgacagatccagcctttgggtct
tcgggaagaccattgttggttttatcttgtatttctcaaggggatgtaaaaagaatgccc
tgtttttatttggctcatgagctgcatctgaatcttctaaatcacccatggctggtccag
gatacagaggctgaaactctgactggttttttgaatggcattgagtggattcttgaagaa
gtggaatctaagcgtgcaagatga

KEGG   Homo sapiens (human): 55294
Entry
55294             CDS       T01001                                 
Symbol
FBXW7, AGO, CDC4, DEDHIL, FBW6, FBW7, FBX30, FBXO30, FBXW6, SEL-10, SEL10, hAgo, hCdc4
Name
(RefSeq) F-box and WD repeat domain containing 7
  KO
K10260  F-box and WD-40 domain protein 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    55294 (FBXW7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55294 (FBXW7)
   04121 Ubiquitin system [BR:hsa04121]
    55294 (FBXW7)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    55294 (FBXW7)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     55294 (FBXW7)
SSDB
Motif
Pfam: WD40 Nup160 ANAPC4_WD40 F-box-like NBCH_WD40 F-box Ge1_WD40 PQQ_2 WD40_like eIF2A CDtoxinA PALB2_WD40 Mem_trans Nop14
Other DBs
NCBI-GeneID: 55294
NCBI-ProteinID: NP_361014
OMIM: 606278
HGNC: 16712
Ensembl: ENSG00000109670
Pharos: Q969H0(Tbio)
UniProt: Q969H0
Structure
LinkDB
Position
4:complement(152320544..152536092)
AA seq 707 aa
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVV
GVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQ
ESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRS
FSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKM
FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHR
IDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRD
ATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL
VTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgaatcaggaactgctctctgtgggcagcaaaagacgacgaactggaggctctctgaga
ggtaacccttcctcaagccaggtagatgaagaacagatgaatcgtgtggtagaggaggaa
cagcaacagcaactcagacaacaagaggaggagcacactgcaaggaatggtgaagttgtt
ggagtagaacctagacctggaggccaaaatgattcccagcaaggacagttggaagaaaac
aataatagatttatttcggtagatgaggactcctcaggaaaccaagaagaacaagaggaa
gatgaagaacatgctggtgaacaagatgaggaggatgaggaggaggaggagatggaccag
gagagtgacgattttgatcagtctgatgatagtagcagagaagatgaacatacacatact
aacagtgtcacgaactccagtagtattgtggacctgcccgttcaccaactctcctcccca
ttctatacaaaaacaacaaaaatgaaaagaaagttggaccatggttctgaggtccgctct
ttttctttgggaaagaaaccatgcaaagtctcagaatatacaagtaccactgggcttgta
ccatgttcagcaacaccaacaacttttggggacctcagagcagccaatggccaagggcaa
caacgacgccgaattacatctgtccagccacctacaggcctccaggaatggctaaaaatg
tttcagagctggagtggaccagagaaattgcttgctttagatgaactcattgatagttgt
gaaccaacacaagtaaaacatatgatgcaagtgatagaaccccagtttcaacgagacttc
atttcattgctccctaaagagttggcactctatgtgctttcattcctggaacccaaagac
ctgctacaagcagctcagacatgtcgctactggagaattttggctgaagacaaccttctc
tggagagagaaatgcaaagaagaggggattgatgaaccattgcacatcaagagaagaaaa
gtaataaaaccaggtttcatacacagtccatggaaaagtgcatacatcagacagcacaga
attgatactaactggaggcgaggagaactcaaatctcctaaggtgctgaaaggacatgat
gatcatgtgatcacatgcttacagttttgtggtaaccgaatagttagtggttctgatgac
aacactttaaaagtttggtcagcagtcacaggcaaatgtctgagaacattagtgggacat
acaggtggagtatggtcatcacaaatgagagacaacatcatcattagtggatctacagat
cggacactcaaagtgtggaatgcagagactggagaatgtatacacaccttatatgggcat
acttccactgtgcgttgtatgcatcttcatgaaaaaagagttgttagcggttctcgagat
gccactcttagggtttgggatattgagacaggccagtgtttacatgttttgatgggtcat
gttgcagcagtccgctgtgttcaatatgatggcaggagggttgttagtggagcatatgat
tttatggtaaaggtgtgggatccagagactgaaacctgtctacacacgttgcaggggcat
actaatagagtctattcattacagtttgatggtatccatgtggtgagtggatctcttgat
acatcaatccgtgtttgggatgtggagacagggaattgcattcacacgttaacagggcac
cagtcgttaacaagtggaatggaactcaaagacaatattcttgtctctgggaatgcagat
tctacagttaaaatctgggatatcaaaacaggacagtgtttacaaacattgcaaggtccc
aacaagcatcagagtgctgtgacctgtttacagttcaacaagaactttgtaattaccagc
tcagatgatggaactgtaaaactatgggacttgaaaacgggtgaatttattcgaaaccta
gtcacattggagagtggggggagtgggggagttgtgtggcggatcagagcctcaaacaca
aagctggtgtgtgcagttgggagtcggaatgggactgaagaaaccaagctgctggtgctg
gactttgatgtggacatgaagtga

KEGG   Homo sapiens (human): 6502
Entry
6502              CDS       T01001                                 
Symbol
SKP2, FBL1, FBXL1, FLB1, p45
Name
(RefSeq) S-phase kinase associated protein 2
  KO
K03875  F-box and leucine-rich repeat protein 1 (S-phase kinase-associated protein 2)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04120  Ubiquitin mediated proteolysis
hsa04150  mTOR signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05222  Small cell lung cancer
Network
nt06130  Cell cycle (viruses)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00484  EBV EBNA3C to cell cycle G1/S
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    6502 (SKP2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    6502 (SKP2)
   04150 mTOR signaling pathway
    6502 (SKP2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    6502 (SKP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    6502 (SKP2)
   05203 Viral carcinogenesis
    6502 (SKP2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    6502 (SKP2)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    6502 (SKP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    6502 (SKP2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     6502 (SKP2)
SSDB
Motif
Pfam: F-box-like F-box FBXL18_LRR F-box_5 LRR_8
Other DBs
NCBI-GeneID: 6502
NCBI-ProteinID: NP_005974
OMIM: 601436
HGNC: 10901
Ensembl: ENSG00000145604
Pharos: Q13309(Tbio)
UniProt: Q13309 A0A024R069
Structure
LinkDB
Position
5:36152111..36193530
AA seq 424 aa
MHRKHLQEIPDLSSNVATSFTWGWDSSKTSELLSGMGVSALEKEEPDSENIPQELLSNLG
HPESPPRKRLKSKGSDKDFVIVRRPKLNRENFPGVSWDSLPDELLLGIFSCLCLPELLKV
SGVCKRWYRLASDESLWQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSP
FRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGC
SGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKS
DLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSRCYDIIPETLLELGEIP
TLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFTTIARPTIGNKKNQEIWGIKCRLTLQK
PSCL
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgcacaggaagcacctccaggagattccagacctgagtagcaacgttgccaccagcttc
acgtggggatgggattccagcaagacttctgaactgctgtcaggcatgggggtctccgcc
ctggagaaagaggagcccgacagtgagaacatcccccaggaactgctctcaaacctgggc
cacccggagagccccccacggaaacggctgaagagcaaagggagtgacaaagactttgtg
attgtccgcaggcctaagctaaatcgagagaactttccaggtgtttcatgggactccctt
ccggatgagctgctcttgggaatcttttcctgtctgtgcctccctgagctgctaaaggtc
tctggtgtttgtaagaggtggtatcgcctagcgtctgatgagtctctatggcagacctta
gacctcacaggtaaaaatctgcacccggatgtgactggtcggttgctgtctcaaggggtg
attgccttccgctgcccacgatcatttatggaccaaccattggctgaacatttcagccct
tttcgtgtacagcacatggacctatcgaactcagttatagaagtgtccaccctccacggc
atactgtctcagtgttccaagttgcagaatctaagcctggaaggcctgcggctttcggat
cccattgtcaatactctcgcaaaaaactcaaatttagtgcgacttaacctttctgggtgt
tctggattctctgaatttgccctgcagactttgctaagcagctgttccagactggatgag
ctgaacctctcctggtgttttgatttcactgaaaagcatgtacaggtggctgttgcgcat
gtgtcagagaccatcacccagctgaatcttagcggctacagaaagaatctccagaaatca
gatctctctactttagttagaagatgccccaatcttgtccatctagacttaagtgatagt
gtcatgctaaagaatgactgctttcaggaatttttccagctcaactacctccaacaccta
tcactcagtcggtgctatgatataatacctgaaactttacttgaacttggagaaattccc
acactaaaaacactacaagtttttggaatcgtgccagatggtacccttcaactgttaaag
gaagcccttcctcatctacagattaattgctcccatttcaccaccattgccaggccaact
attggcaacaaaaagaaccaggagatatggggcatcaaatgccgactgacactgcaaaag
cccagttgtctatga

KEGG   Homo sapiens (human): 8945
Entry
8945              CDS       T01001                                 
Symbol
BTRC, BETA-TRCP, FBW1A, FBXW1, FBXW1A, FWD1, bTrCP, bTrCP1, betaTrCP
Name
(RefSeq) beta-transducin repeat containing E3 ubiquitin protein ligase
  KO
K03362  F-box and WD-40 domain protein 1/11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04114  Oocyte meiosis
hsa04120  Ubiquitin mediated proteolysis
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa04710  Circadian rhythm
hsa05131  Shigellosis
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06516  TNF signaling
  Element
N00942  Shigella OspG to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    8945 (BTRC)
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8945 (BTRC)
   04340 Hedgehog signaling pathway
    8945 (BTRC)
   04390 Hippo signaling pathway
    8945 (BTRC)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    8945 (BTRC)
   04218 Cellular senescence
    8945 (BTRC)
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    8945 (BTRC)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    8945 (BTRC)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8945 (BTRC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    8945 (BTRC)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8945 (BTRC)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     8945 (BTRC)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     8945 (BTRC)
SSDB
Motif
Pfam: WD40 Beta-TrCP_D F-box-like ANAPC4_WD40 NBCH_WD40 F-box WD40_like Nup160 F-box_5 Frtz DUF4508 DUF6188
Other DBs
NCBI-GeneID: 8945
NCBI-ProteinID: NP_378663
OMIM: 603482
HGNC: 1144
Ensembl: ENSG00000166167
Pharos: Q9Y297(Tbio)
UniProt: Q9Y297 B2R8L3 A0A0S2Z4P6 Q68DS0
Structure
LinkDB
Position
10:101354048..101557313
AA seq 605 aa
MDPAEAVLQEKALKFMCSMPRSLWLGCSSLADSMPSLRCLYNPGTGALTAFQNSSEREDC
NNGEPPRKIIPEKNSLRQTYNSCARLCLNQETVCLASTAMKTENCVAKTKLANGTSSMIV
PKQRKLSASYEKEKELCVKYFEQWSESDQVEFVEHLISQMCHYQHGHINSYLKPMLQRDF
ITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKLIERMVRTDSLWR
GLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDIETIESNWRCGRHSLQRIHCRS
ETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRILTGHTGSVLCLQYDERVIITGS
SDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMASPTDITLRR
VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVV
SGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDPR
APAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFLNDPAAQAEPPRSPSRTY
TYISR
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggacccggccgaggcggtgctgcaagagaaggcactcaagtttatgtgctctatgccc
aggtctctgtggctgggctgctccagcctggcggacagcatgccttcgctgcgatgcctg
tataacccagggactggcgcactcacagctttccagaattcctcagagagagaagactgt
aataatggcgaaccccctaggaagataataccagagaagaattcacttagacagacatac
aacagctgtgccagactctgcttaaaccaagaaacagtatgtttagcaagcactgctatg
aagactgagaattgtgtggccaaaacaaaacttgccaatggcacttccagtatgattgtg
cccaagcaacggaaactctcagcaagctatgaaaaggaaaaggaactgtgtgtcaaatac
tttgagcagtggtcagagtcagatcaagtggaatttgtggaacatcttatatcccaaatg
tgtcattaccaacatgggcacataaactcgtatcttaaacctatgttgcagagagatttc
ataactgctctgccagctcggggattggatcatattgctgagaacattctgtcatacctg
gatgccaaatcactatgtgctgctgaacttgtgtgcaaggaatggtaccgagtgacctct
gatggcatgctgtggaagaagcttatcgagagaatggtcaggacagattctctgtggaga
ggcctggcagaacgaagaggatggggacagtatttattcaaaaacaaacctcctgacggg
aatgctcctcccaactctttttatagagcactttatcctaaaattatacaagacattgag
acaatagaatctaattggagatgtggaagacatagtttacagagaattcactgccgaagt
gaaacaagcaaaggagtttactgtttacagtatgatgatcagaaaatagtaagcggcctt
cgagacaacacaatcaagatctgggataaaaacacattggaatgcaagcgaattctcaca
ggccatacaggttcagtcctctgtctccagtatgatgagagagtgatcataacaggatca
tcggattccacggtcagagtgtgggatgtaaatacaggtgaaatgctaaacacgttgatt
caccattgtgaagcagttctgcacttgcgtttcaataatggcatgatggtgacctgctcc
aaagatcgttccattgctgtatgggatatggcctccccaactgacattaccctccggagg
gtgctggtcggacaccgagctgctgtcaatgttgtagactttgatgacaagtacattgtt
tctgcatctggggatagaactataaaggtatggaacacaagtacttgtgaatttgtaagg
accttaaatggacacaaacgaggcattgcctgtttgcagtacagggacaggctggtagtg
agtggctcatctgacaacactatcagattatgggacatagaatgtggtgcatgtttacga
gtgttagaaggccatgaggaattggtgcgttgtattcgatttgataacaagaggatagtc
agtggggcctatgatggaaaaattaaagtgtgggatcttgtggctgctttggacccccgt
gctcctgcagggacactctgtctacggacccttgtggagcattccggaagagtttttcga
ctacagtttgatgaattccagattgtcagtagttcacatgatgacacaatcctcatctgg
gacttcctaaatgatccagctgcccaagctgaacccccccgttccccttctcgaacatac
acctacatctccagataa

DBGET integrated database retrieval system