KEGG   Homo sapiens (human): 2534
Entry
2534              CDS       T01001                                 
Symbol
FYN, SLK, SYN, p59-FYN
Name
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04611  Platelet activation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04725  Cholinergic synapse
hsa05020  Prion disease
hsa05130  Pathogenic Escherichia coli infection
hsa05416  Viral myocarditis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06415  PI3K signaling
nt06465  Prion disease
  Element
N01093  Escherichia EspJ/Tir to Actin signaling pathway
N01204  PRNP-PI3K-NOX2 signaling pathway
N01205  Scrapie conformation PrPSc to PRNP-PI3K-NOX2 signaling pathway
Drug target
Dasatinib (DG00714): D03658<JP> D06414<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2534 (FYN)
   04071 Sphingolipid signaling pathway
    2534 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2534 (FYN)
   04520 Adherens junction
    2534 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2534 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    2534 (FYN)
   04660 T cell receptor signaling pathway
    2534 (FYN)
   04664 Fc epsilon RI signaling pathway
    2534 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    2534 (FYN)
  09158 Development and regeneration
   04360 Axon guidance
    2534 (FYN)
   04380 Osteoclast differentiation
    2534 (FYN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2534 (FYN)
  09164 Neurodegenerative disease
   05020 Prion disease
    2534 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    2534 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2534 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2534 (FYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2534 (FYN)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2534 (FYN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    2534 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    2534 (FYN)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 ABC1 SH3_3 zf-RING_14 Haspin_kinase
Other DBs
NCBI-GeneID: 2534
NCBI-ProteinID: NP_002028
OMIM: 137025
HGNC: 4037
Ensembl: ENSG00000010810
Pharos: P06241(Tclin)
UniProt: P06241
Structure
LinkDB
Position
6:complement(111660332..111873452)
AA seq 537 aa
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatccccaactacaacaacttccacgcagccgggggccaagga
ctcaccgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactctttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactacattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctatgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaacaaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgacttcggattggcccgattgatagaagacaatgagtac
acagcaagacaaggtgcaaagttccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctg
gaagactactttaccgcgacagagccccagtaccaacctggtgaaaacctgtaa

KEGG   Homo sapiens (human): 25
Entry
25                CDS       T01001                                 
Symbol
ABL1, ABL, BCR-ABL, CHDSKM, JTK7, bcr/abl, c-ABL, c-ABL1, p150, v-abl
Name
(RefSeq) ABL proto-oncogene 1, non-receptor tyrosine kinase
  KO
K06619  abelson tyrosine-protein kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04014  Ras signaling pathway
hsa04110  Cell cycle
hsa04360  Axon guidance
hsa04722  Neurotrophin signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05220  Chronic myeloid leukemia
hsa05416  Viral myocarditis
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06223  TNF signaling
nt06276  Chronic myeloid leukemia
  Element
N00002  BCR-ABL fusion kinase to RAS-ERK signaling pathway
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
N00055  BCR-ABL fusion kinase to Jak-STAT signaling pathway
N01093  Escherichia EspJ/Tir to Actin signaling pathway
N01411  Metals to NFKB signaling pathway
N10001  First-generation tyrosine kinase inhibitor to BCR-ABL fusion
N10002  Second/third-generation tyrosine kinase inhibitor to BCR-ABL fusion
Disease
H00001  B-cell acute lymphoblastic leukemia
H00004  Chronic myeloid leukemia
Drug target
Asciminib (DG03004): D11403 D11404<JP/US>
Bafetinib: D10202
Bosutinib (DG00718): D03252 D09728<JP/US>
Dasatinib (DG00714): D03658<JP> D06414<JP/US>
Imatinib (DG00710): D01441<JP/US> D08066
Nilotinib (DG00716): D06413<JP/US> D08953
Olverembatinib: D12175
Ponatinib (DG00722): D09950 D09951<JP/US>
Rebastinib (DG01368): D10334 D10399
Saracatinib (DG01418): D09664 D09665
Tozasertib (DG01365): D08279 D08344
Vodobatinib: D11786
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    25 (ABL1)
   04014 Ras signaling pathway
    25 (ABL1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    25 (ABL1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    25 (ABL1)
  09158 Development and regeneration
   04360 Axon guidance
    25 (ABL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    25 (ABL1)
   05206 MicroRNAs in cancer
    25 (ABL1)
   05208 Chemical carcinogenesis - reactive oxygen species
    25 (ABL1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    25 (ABL1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    25 (ABL1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    25 (ABL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    25 (ABL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25 (ABL1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  ABL family
   25 (ABL1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase F_actin_bind SH2 SH3_1 SH3_2 SH3_9 SH3_3 Haspin_kinase Kinase-like SH3_6 ABC1
Other DBs
NCBI-GeneID: 25
NCBI-ProteinID: NP_005148
OMIM: 189980
HGNC: 76
Ensembl: ENSG00000097007
Pharos: P00519(Tclin)
UniProt: P00519 A0A024R8E2 Q59FK4
Structure
LinkDB
Position
9:130713043..130887675
AA seq 1130 aa
MLEICLKLVGCKSKKGLSSSSSCYLEEALQRPVASDFEPQGLSEAARWNSKENLLAGPSE
NDPNLFVALYDFVASGDNTLSITKGEKLRVLGYNHNGEWCEAQTKNGQGWVPSNYITPVN
SLEKHSWYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTAS
DGKLYVSSESRFNTLAELVHHHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERT
DITMKHKLGGGQYGEVYEGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQ
LLGVCTREPPFYIITEFMTYGNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFI
HRDLAARNCLVGENHLVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKS
DVWAFGVLLWEIATYGMSPYPGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNP
SDRPSFAEIHQAFETMFQESSISDEVEKELGKQGVRGAVSTLLQAPELPTKTRTSRRAAE
HRDTTDVPEMPHSKGQGESDPLDHEPAVSPLLPRKERGPPEGGLNEDERLLPKDKKTNLF
SALIKKKKKTAPTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSP
KPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLTSSRLATGEEEGGGSSSKRFLRSCSAS
CVPHGAKDTEWRSVTLPRDLQSTGRQFDSSTFGGHKSEKPALPRKRAGENRSDQVTRGTV
TPPPRLVKKNEEAADEVFKDIMESSPGSSPPNLTPKPLRRQVTVAPASGLPHKEEAGKGS
ALGTPAAAEPVTPTSKAGSGAPGGTSKGPAEESRVRRHKHSSESPGRDKGKLSRLKPAPP
PPPAASAGKAGGKPSQSPSQEAAGEAVLGAKTKATSLVDAVNSDAAKPSQPGEGLKKPVL
PATPKPQSAKPSGTPISPAPVPSTLPSASSALAGDQPSSTAFIPLISTRVSLRKTRQPPE
RIASGAITKGVVLDSTEALCLAISRNSEQMASHSAVLEAGKNLYTFCVSYVDSIQQMRNK
FAFREAINKLENNLRELQICPATAGSGPAATQDFSKLLSSVKEISDIVQR
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgttggagatctgcctgaagctggtgggctgcaaatccaagaaggggctgtcctcgtcc
tccagctgttatctggaagaagcccttcagcggccagtagcatctgactttgagcctcag
ggtctgagtgaagccgctcgttggaactccaaggaaaaccttctcgctggacccagtgaa
aatgaccccaaccttttcgttgcactgtatgattttgtggccagtggagataacactcta
agcataactaaaggtgaaaagctccgggtcttaggctataatcacaatggggaatggtgt
gaagcccaaaccaaaaatggccaaggctgggtcccaagcaactacatcacgccagtcaac
agtctggagaaacactcctggtaccatgggcctgtgtcccgcaatgccgctgagtatctg
ctgagcagcgggatcaatggcagcttcttggtgcgtgagagtgagagcagtcctggccag
aggtccatctcgctgagatacgaagggagggtgtaccattacaggatcaacactgcttct
gatggcaagctctacgtctcctccgagagccgcttcaacaccctggccgagttggttcat
catcattcaacggtggccgacgggctcatcaccacgctccattatccagccccaaagcgc
aacaagcccactgtctatggtgtgtcccccaactacgacaagtgggagatggaacgcacg
gacatcaccatgaagcacaagctgggcgggggccagtacggggaggtgtacgagggcgtg
tggaagaaatacagcctgacggtggccgtgaagaccttgaaggaggacaccatggaggtg
gaagagttcttgaaagaagctgcagtcatgaaagagatcaaacaccctaacctggtgcag
ctccttggggtctgcacccgggagcccccgttctatatcatcactgagttcatgacctac
gggaacctcctggactacctgagggagtgcaaccggcaggaggtgaacgccgtggtgctg
ctgtacatggccactcagatctcgtcagccatggagtacctggagaagaaaaacttcatc
cacagagatcttgctgcccgaaactgcctggtaggggagaaccacttggtgaaggtagct
gattttggcctgagcaggttgatgacaggggacacctacacagcccatgctggagccaag
ttccccatcaaatggactgcacccgagagcctggcctacaacaagttctccatcaagtcc
gacgtctgggcatttggagtattgctttgggaaattgctacctatggcatgtccccttac
ccgggaattgacctgtcccaggtgtatgagctgctagagaaggactaccgcatggagcgc
ccagaaggctgcccagagaaggtctatgaactcatgcgagcatgttggcagtggaatccc
tctgaccggccctcctttgctgaaatccaccaagcctttgaaacaatgttccaggaatcc
agtatctcagacgaagtggaaaaggagctggggaaacaaggcgtccgtggggctgtgagt
accttgctgcaggccccagagctgcccaccaagacgaggacctccaggagagctgcagag
cacagagacaccactgacgtgcctgagatgcctcactccaagggccagggagagagcgat
cctctggaccatgagcctgccgtgtctccattgctccctcgaaaagagcgaggtcccccg
gagggcggcctgaatgaagatgagcgccttctccccaaagacaaaaagaccaacttgttc
agcgccttgatcaagaagaagaagaagacagccccaacccctcccaaacgcagcagctcc
ttccgggagatggacggccagccggagcgcagaggggccggcgaggaagagggccgagac
atcagcaacggggcactggctttcacccccttggacacagctgacccagccaagtcccca
aagcccagcaatggggctggggtccccaatggagccctccgggagtccgggggctcaggc
ttccggtctccccacctgtggaagaagtccagcacgctgaccagcagccgcctagccacc
ggcgaggaggagggcggtggcagctccagcaagcgcttcctgcgctcttgctccgcctcc
tgcgttccccatggggccaaggacacggagtggaggtcagtcacgctgcctcgggacttg
cagtccacgggaagacagtttgactcgtccacatttggagggcacaaaagtgagaagccg
gctctgcctcggaagagggcaggggagaacaggtctgaccaggtgacccgaggcacagta
acgcctccccccaggctggtgaaaaagaatgaggaagctgctgatgaggtcttcaaagac
atcatggagtccagcccgggctccagcccgcccaacctgactccaaaacccctccggcgg
caggtcaccgtggcccctgcctcgggcctcccccacaaggaagaagctggaaagggcagt
gccttagggacccctgctgcagctgagccagtgacccccaccagcaaagcaggctcaggt
gcaccagggggcaccagcaagggccccgccgaggagtccagagtgaggaggcacaagcac
tcctctgagtcgccagggagggacaaggggaaattgtccaggctcaaacctgccccgccg
cccccaccagcagcctctgcagggaaggctggaggaaagccctcgcagagcccgagccag
gaggcggccggggaggcagtcctgggcgcaaagacaaaagccacgagtctggttgatgct
gtgaacagtgacgctgccaagcccagccagccgggagagggcctcaaaaagcccgtgctc
ccggccactccaaagccacagtccgccaagccgtcggggacccccatcagcccagccccc
gttccctccacgttgccatcagcatcctcggccctggcaggggaccagccgtcttccacc
gccttcatccctctcatatcaacccgagtgtctcttcggaaaacccgccagcctccagag
cggatcgccagcggcgccatcaccaagggcgtggtcctggacagcaccgaggcgctgtgc
ctcgccatctctaggaactccgagcagatggccagccacagcgcagtgctggaggccggc
aaaaacctctacacgttctgcgtgagctatgtggattccatccagcaaatgaggaacaag
tttgccttccgagaggccatcaacaaactggagaataatctccgggagcttcagatctgc
ccggcgacagcaggcagtggtccagcggccactcaggacttcagcaagctcctcagttcg
gtgaaggaaatcagtgacatagtgcagaggtag

DBGET integrated database retrieval system