KEGG   Homo sapiens (human): 405
Entry
405               CDS       T01001                                 
Symbol
ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Name
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04934  Cushing syndrome
hsa05200  Pathways in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05211  Renal cell carcinoma
Network
nt06225  HIF-1 signaling
nt06227  Nuclear receptor signaling
nt06264  Renal cell carcinoma
nt06360  Cushing syndrome
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00317  AhR signaling pathway
N01365  TCDD to Ahr signaling pathway
N01366  BaP to Ahr signaling pathway
N01367  PCB to Ahr signaling pathway
N01368  HCB to Ahr signaling pathway
N01412  Metals to HTF-1 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    405 (ARNT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    405 (ARNT)
   05207 Chemical carcinogenesis - receptor activation
    405 (ARNT)
   05208 Chemical carcinogenesis - reactive oxygen species
    405 (ARNT)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    405 (ARNT)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    405 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    405 (ARNT)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    405 (ARNT)
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HLH PAS_9 PAS_4 PRAS
Other DBs
NCBI-GeneID: 405
NCBI-ProteinID: NP_001659
OMIM: 126110
HGNC: 700
Ensembl: ENSG00000143437
Vega: OTTHUMG00000035011
Pharos: P27540(Tbio)
UniProt: P27540
Structure
LinkDB
Position
1:complement(150809713..150876599)
AA seq 789 aa
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
NT seq 2370 nt   +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaactctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcacagtgaaattgaacggcgg
cgacggaacaagatgacagcctacatcacagaactgtcagatatggtacccacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatgaag
tccttgcggggaactggcaacacatccactgatggctcctataagccgtctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggcagggtggtgtatgtgtctgactccgtgactcctgttttgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggataaa
cttcgtgagcagctttccacttcagaaaatgccctgacagggcgtatcctggatctaaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgagaatgtgtatgggctcaagg
agatcgtttatttgccgaatgaggtgtggcagtagctctgtggacccagtttctgtgaat
aggctgagctttgtgaggaacagatgcaggaatggacttggctctgtaaaggatggggaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtt
tccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggccatt
ggcagattgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcaacca
acagagttcatctcccgacacaacattgagggtatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggaactcttaggaaagaatattgtagaattctgt
catcctgaagaccagcagcttctaagagacagcttccaacaggtagtgaaattaaaaggc
caagtgctgtctgtcatgttccggttccggtctaagaaccaagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatctgtacc
aacaccaatgtgaagaactctagccaagaaccacggcctacactctccaacacaatccag
aggccacaactaggtcccacagctaatttacccctggagatgggctcaggacagctggca
cccaggcagcagcaacagcaaacagaattggacatggtaccaggaagagatggactggcc
agctacaatcattcccaggtggttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtttatttgcccaggatagagatccaagattttcagaaatc
tatcacaacatcaatgcggatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggcctagcccctcctgtaaccattgtccagccatcagcttctgcaggacag
atgttggcccagatttcccgccactccaaccccacccaaggagcaaccccaacttggacc
cctactacccgctcaggcttttctgcccagcaggtggctacccaggctactgctaagact
cgtacttcccagtttggtgtgggcagctttcagactccatcctccttcagctccatgtcc
ctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagtctcaccaatcgt
ggatctaactttgctcctgagactggacagactgcaggacaattccagacacggacagca
gagggtgtgggtgtctggccacagtggcagggccagcagcctcatcatcgttcaagttct
agtgagcaacatgttcaacaaccgccagcacagcaacctggccagcctgaggtcttccag
gagatgctgtccatgctgggagatcagagcaacagctacaacaatgaagaattccctgat
ctaactatgtttccccccttttcagaatag

DBGET integrated database retrieval system