KEGG   Homo sapiens (human): 9641
Entry
9641              CDS       T01001                                 

Symbol
IKBKE, IKK-E, IKK-i, IKKE, IKKI
Name
(RefSeq) inhibitor of nuclear factor kappa B kinase subunit epsilon
  KO
K07211  inhibitor of nuclear factor kappa-B kinase subunit epsilon [EC:2.7.11.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04936  Alcoholic liver disease
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05171  Coronavirus disease - COVID-19
hsa05207  Chemical carcinogenesis - receptor activation
hsa05417  Lipid and atherosclerosis
Network
nt06121  TLR signaling (viruses and bacteria)
nt06133  RLR signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06221  TLR signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00149  TLR3-IRF3 signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00552  HBV pol to TLR3-IRF3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00734  IAV PB1-F2/PB2 to RIG-I-like receptor signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
N01341  NNK/NNN to Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    9641 (IKBKE)
   04621 NOD-like receptor signaling pathway
    9641 (IKBKE)
   04622 RIG-I-like receptor signaling pathway
    9641 (IKBKE)
   04623 Cytosolic DNA-sensing pathway
    9641 (IKBKE)
   04625 C-type lectin receptor signaling pathway
    9641 (IKBKE)
   04657 IL-17 signaling pathway
    9641 (IKBKE)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    9641 (IKBKE)
  09172 Infectious disease: viral
   05161 Hepatitis B
    9641 (IKBKE)
   05160 Hepatitis C
    9641 (IKBKE)
   05171 Coronavirus disease - COVID-19
    9641 (IKBKE)
   05164 Influenza A
    9641 (IKBKE)
   05162 Measles
    9641 (IKBKE)
   05168 Herpes simplex virus 1 infection
    9641 (IKBKE)
   05167 Kaposi sarcoma-associated herpesvirus infection
    9641 (IKBKE)
   05169 Epstein-Barr virus infection
    9641 (IKBKE)
   05165 Human papillomavirus infection
    9641 (IKBKE)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    9641 (IKBKE)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    9641 (IKBKE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    9641 (IKBKE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.10  IkappaB kinase
     9641 (IKBKE)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   9641 (IKBKE)
SSDB
Motif
Pfam: TBK1_CCD1 Pkinase TBK1_ULD PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH zf-RING_9 RIO1 DUF5798
Other DBs
NCBI-GeneID: 9641
NCBI-ProteinID: NP_054721
OMIM: 605048
HGNC: 14552
Ensembl: ENSG00000263528
Vega: OTTHUMG00000184613
Pharos: Q14164(Tchem)
UniProt: Q14164
LinkDB
Position
1q32.1
AA seq 716 aa
MQSTANYLWHTDDLLGQGATASVYKARNKKSGELVAVKVFNTTSYLRPREVQVREFEVLR
KLNHQNIVKLFAVEETGGSRQKVLVMEYCSSGSLLSVLESPENAFGLPEDEFLVVLRCVV
AGMNHLRENGIVHRDIKPGNIMRLVGEEGQSIYKLTDFGAARELDDDEKFVSVYGTEEYL
HPDMYERAVLRKPQQKAFGVTVDLWSIGVTLYHAATGSLPFIPFGGPRRNKEIMYRITTE
KPAGAIAGAQRRENGPLEWSYTLPITCQLSLGLQSQLVPILANILEVEQAKCWGFDQFFA
ETSDILQRVVVHVFSLSQAVLHHIYIHAHNTIAIFQEAVHKQTSVAPRHQEYLFEGHLCV
LEPSVSAQHIAHTTASSPLTLFSTAIPKGLAFRDPALDVPKFVPKVDLQADYNTAKGVLG
AGYQALRLARALLDGQELMFRGLHWVMEVLQATCRRTLEVARTSLLYLSSSLGTERFSSV
AGTPEIQELKAAAELRSRLRTLAEVLSRCSQNITETQESLSSLNRELVKSRDQVHEDRSI
QQIQCCLDKMNFIYKQFKKSRMRPGLGYNEEQIHKLDKVNFSHLAKRLLQVFQEECVQKY
QASLVTHGKRMRVVHETRNHLRLVGCSVAACNTEAQGVQESLSKLLEELSHQLLQDRAKG
AQASPPPIAPYPSPTRKDLLLHMQELCEGMKLLASDLLDNNRIIERLNRVPAPPDV
NT seq 2151 nt   +upstreamnt  +downstreamnt
atgcagagcacagccaattacctgtggcacacagatgacctgctggggcagggggccact
gccagtgtgtacaaggcccgcaacaagaaatccggagagctggttgctgtgaaggtcttc
aacactaccagctacctgcggccccgcgaggtgcaggtgagggagtttgaggtcctgcgg
aagctgaaccaccagaacattgtcaagctctttgcggtggaggagacgggcggaagccgg
cagaaggtactggtgatggagtactgctccagtgggagcctgctgagtgtgctggagagc
cctgagaatgcctttgggctgcctgaggatgagttcctggtggtgctgcgctgtgtggtg
gccggcatgaaccacctgcgggagaacggcattgtgcatcgcgacatcaagccggggaac
atcatgcgcctcgtaggggaggaggggcagagcatctacaagctgacagacttcggcgct
gcccgggagctggatgatgatgagaagttcgtctcggtctatgggactgaggagtacctg
catcccgacatgtatgagcgggcggtgcttcgaaagccccagcaaaaagcgttcggggtg
actgtggatctctggagcattggagtgaccttgtaccatgcagccactggcagcctgccc
ttcatcccctttggtgggccacggcggaacaaggagatcatgtaccggatcaccacggag
aagccggctggggccattgcaggtgcccagaggcgggagaacgggcccctggagtggagc
tacaccctccccatcacctgccagctgtcactggggctgcagagccagctggtgcccatc
ctggccaacatcctggaggtggagcaggccaagtgctggggcttcgaccagttctttgcg
gagaccagtgacatcctgcagcgagttgtcgtccatgtcttctccctgtcccaggcagtc
ctgcaccacatctatatccatgcccacaacacgatagccattttccaggaggccgtgcac
aagcagaccagtgtggccccccgacaccaggagtacctctttgagggtcacctctgtgtc
ctcgagcccagcgtctcagcacagcacatcgcccacacgacggcaagcagccccctgacc
ctcttcagcacagccatccctaaggggctggccttcagggaccctgctctggacgtcccc
aagttcgtccccaaagtggacctgcaggcggattacaacactgccaagggcgtgttgggc
gccggctaccaggccctgcggctggcacgggccctgctggatgggcaggagctaatgttt
cgggggctgcactgggtcatggaggtgctccaggccacatgcagacggactctggaagtg
gcaaggacatccctcctctacctcagcagcagcctgggaactgagaggttcagcagcgtg
gctggaacgcctgagatccaggaactgaaggcggctgcagaactgaggtccaggctgcgg
actctagcggaggtcctctccagatgctcccaaaatatcacggagacccaggagagcctg
agcagcctgaaccgggagctggtgaagagccgggatcaggtacatgaggacagaagcatc
cagcagattcagtgctgtttggacaagatgaacttcatctacaaacagttcaagaagtct
aggatgaggccagggcttggctacaacgaggagcagattcacaagctggataaggtgaat
ttcagtcatttagccaaaagactcctgcaggtgttccaggaggagtgcgtgcagaagtat
caagcgtccttagtcacacacggcaagaggatgagggtggtgcacgagaccaggaaccac
ctgcgcctggttggctgttctgtggctgcctgtaacacagaagcccagggggtccaggag
agtctcagcaagctcctggaagagctatctcaccagctccttcaggaccgagcaaagggg
gctcaggcctcgccgcctcccatagctccttaccccagccctacacgaaaggacctgctt
ctccacatgcaagagctctgcgaggggatgaagctgctggcatctgacctcctggacaac
aaccgcatcatcgaacggctaaatagagtcccagcacctcctgatgtctga

DBGET integrated database retrieval system