KEGG   Homo sapiens (human): 1636
Entry
1636              CDS       T01001                                 

Gene name
ACE, ACE1, CD143, DCP, DCP1
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04924  Renin secretion
hsa05142  Chagas disease
hsa05410  Hypertrophic cardiomyopathy
Disease
H00083  Allograft rejection
H00575  Renal tubular dysgenesis
H01456  Diabetic nephropathy
H01457  Diabetic retinopathy
Drug target
Alacepril: D01900<JP>
Benazepril (DG00339): D00620<JP/US> D07499
Benazeprilat: D03077
Captopril: D00251<JP/US>
Ceronapril: D03440
Cilazapril (DG00340): D01069<JP> D07699
Delapril (DG00343): D01667<JP> D07781
Enalapril (DG00335): D00621<JP/US> D07892
Enalaprilat: D03769<US>
Fosinopril (DG00341): D00622<US> D07992
Fosinoprilat: D03772
Gemopatrilat: D04312
Imidapril (DG00347): D01549<JP> D08068
Indolapril hydrochloride: D03756
Libenzapril: D03758
Lisinopril (DG00336): D00362<JP/US> D08131
Moexipril (DG00344): D00623<US> D08225
Pentopril: D03760
Perindopril (DG00337): D00624<JP/US> D03753 D11580
Pivopril: D03763
Quinapril (DG00338): D00459<JP/US> D03752
Quinaprilat: D03773
Ramipril: D00421<US>
Spirapril (DG00342): D03765 D08529
Spiraprilat: D03775
Temocapril (DG00345): D01119<JP> D08566
Teprotide: D06076
Trandolapril: D00383<JP/US>
Zofenopril (DG00346): D03767 D08688
Zofenoprilat arginine: D03776
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1636 (ACE)
   04614 Renin-angiotensin system
    1636 (ACE)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    1636 (ACE)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    1636 (ACE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1636 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1636 (ACE)
   04090 CD molecules [BR:hsa04090]
    1636 (ACE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     1636 (ACE)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M2
   1636 (ACE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1636 (ACE)
CD molecules [BR:hsa04090]
 Proteins
  1636 (ACE)
SSDB
Motif
Pfam: Peptidase_M2 Peptidase_M32
Other DBs
NCBI-GeneID: 1636
NCBI-ProteinID: NP_000780
OMIM: 106180
HGNC: 2707
Ensembl: ENSG00000159640
Vega: OTTHUMG00000154927
Pharos: P12821(Tclin)
UniProt: P12821 B4DKH4
LinkDB
Structure
PDB: 

Position
17q23.3
AA seq 1306 aa
MGAASGRRGPGLLLPLPLLLLLPPQPALALDPGLQPGNFSADEAGAQLFAQSYNSSAEQV
LFQSVAASWAHDTNITAENARRQEEAALLSQEFAEAWGQKAKELYEPIWQNFTDPQLRRI
IGAVRTLGSANLPLAKRQQYNALLSNMSRIYSTAKVCLPNKTATCWSLDPDLTNILASSR
SYAMLLFAWEGWHNAAGIPLKPLYEDFTALSNEAYKQDGFTDTGAYWRSWYNSPTFEDDL
EHLYQQLEPLYLNLHAFVRRALHRRYGDRYINLRGPIPAHLLGDMWAQSWENIYDMVVPF
PDKPNLDVTSTMLQQGWNATHMFRVAEEFFTSLELSPMPPEFWEGSMLEKPADGREVVCH
ASAWDFYNRKDFRIKQCTRVTMDQLSTVHHEMGHIQYYLQYKDLPVSLRRGANPGFHEAI
GDVLALSVSTPEHLHKIGLLDRVTNDTESDINYLLKMALEKIAFLPFGYLVDQWRWGVFS
GRTPPSRYNFDWWYLRTKYQGICPPVTRNETHFDAGAKFHVPNVTPYIRYFVSFVLQFQF
HEALCKEAGYEGPLHQCDIYRSTKAGAKLRKVLQAGSSRPWQEVLKDMVGLDALDAQPLL
KYFQPVTQWLQEQNQQNGEVLGWPEYQWHPPLPDNYPEGIDLVTDEAEASKFVEEYDRTS
QVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKRI
IKKVQDLERAALPAQELEEYNKILLDMETTYSVATVCHPNGSCLQLEPDLTNVMATSRKY
EDLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLER
LFQELQPLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPS
APSMDTTEAMLKQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHAS
AWDFYNGKDFRIKQCTTVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGD
VLALSVSTPKHLHSLNLLSSEGGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGS
ITKENYNQEWWSLRLKYQGLCPPVPRTQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHE
ALCQAAGHTGPLHKCDIYQSKEAGQRLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSY
FKPLLDWLRTENELHGEKLGWPQYNWTPNSARSEGPLPDSGRVSFLGLDLDAQQARVGQW
LLLFLGIALLVATLGLSQRLFSIRHRSLHRHSHGPQFGSEVELRHS
NT seq 3921 nt   +upstreamnt  +downstreamnt
atgggggccgcctcgggccgccgggggccggggctgctgctgccgctgccgctgctgttg
ctgctgccgccgcagcccgccctggcgttggaccccgggctgcagcccggcaacttttct
gctgacgaggccggggcgcagctcttcgcgcagagctacaactccagcgccgaacaggtg
ctgttccagagcgtggccgccagctgggcgcacgacaccaacatcaccgcggagaatgca
aggcgccaggaggaagcagccctgctcagccaggagtttgcggaggcctggggccagaag
gccaaggagctgtatgaaccgatctggcagaacttcacggacccgcagctgcgcaggatc
atcggagctgtgcgcaccctgggctctgccaacctgcccctggctaagcggcagcagtac
aacgccctgctaagcaacatgagcaggatctactccaccgccaaggtctgcctccccaac
aagactgccacctgctggtccctggacccagatctcaccaacatcctggcttcctcgcga
agctacgccatgctcctgtttgcctgggagggctggcacaacgctgcgggcatcccgctg
aaaccgctgtacgaggatttcactgccctcagcaatgaagcctacaagcaggacggcttc
acagacacgggggcctactggcgctcctggtacaactcccccaccttcgaggacgatctg
gaacacctctaccaacagctagagcccctctacctgaacctccatgccttcgtccgccgc
gcactgcatcgccgatacggagacagatacatcaacctcaggggacccatccctgctcat
ctgctgggagacatgtgggcccagagctgggaaaacatctacgacatggtggtgcctttc
ccagacaagcccaacctcgatgtcaccagtactatgctgcagcagggctggaacgccacg
cacatgttccgggtggcagaggagttcttcacctccctggagctctcccccatgcctccc
gagttctgggaagggtcgatgctggagaagccggccgacgggcgggaagtggtgtgccac
gcctcggcttgggacttctacaacaggaaagacttcaggatcaagcagtgcacacgggtc
acgatggaccagctctccacagtgcaccatgagatgggccatatacagtactacctgcag
tacaaggatctgcccgtctccctgcgtcggggggccaaccccggcttccatgaggccatt
ggggacgtgctggcgctctcggtctccactcctgaacatctgcacaaaatcggcctgctg
gaccgtgtcaccaatgacacggaaagtgacatcaattacttgctaaaaatggcactggaa
aaaattgccttcctgccctttggctacttggtggaccagtggcgctggggggtctttagt
gggcgtacccccccttcccgctacaacttcgactggtggtatcttcgaaccaagtatcag
gggatctgtcctcctgttacccgaaacgaaacccactttgatgctggagctaagtttcat
gttccaaatgtgacaccatacatcaggtactttgtgagttttgtcctgcagttccagttc
catgaagccctgtgcaaggaggcaggctatgagggcccactgcaccagtgtgacatctac
cggtccaccaaggcaggggccaagctccggaaggtgctgcaggctggctcctccaggccc
tggcaggaggtgctgaaggacatggtcggcttagatgccctggatgcccagccgctgctc
aagtacttccagccagtcacccagtggctgcaggagcagaaccagcagaacggcgaggtc
ctgggctggcccgagtaccagtggcacccgccgttgcctgacaactacccggagggcata
gacctggtgactgatgaggctgaggccagcaagtttgtggaggaatatgaccggacatcc
caggtggtgtggaacgagtatgccgaggccaactggaactacaacaccaacatcaccaca
gagaccagcaagattctgctgcagaagaacatgcaaatagccaaccacaccctgaagtac
ggcacccaggccaggaagtttgatgtgaaccagttgcagaacaccactatcaagcggatc
ataaagaaggttcaggacctagaacgggcagcactgcctgcccaggagctggaggagtac
aacaagatcctgttggatatggaaaccacctacagcgtggccactgtgtgccacccgaat
ggcagctgcctgcagctcgagccagatctgacgaatgtgatggccacgtcccggaaatat
gaagacctgttatgggcatgggagggctggcgagacaaggcggggagagccatcctccag
ttttacccgaaatacgtggaactcatcaaccaggctgcccggctcaatggctatgtagat
gcaggggactcgtggaggtctatgtacgagacaccatccctggagcaagacctggagcgg
ctcttccaggagctgcagccactctacctcaacctgcatgcctacgtgcgccgggccctg
caccgtcactacggggcccagcacatcaacctggaggggcccattcctgctcacctgctg
gggaacatgtgggcgcagacctggtccaacatctatgacttggtggtgcccttcccttca
gccccctcgatggacaccacagaggctatgctaaagcagggctggacgcccaggaggatg
tttaaggaggctgatgatttcttcacctccctggggctgctgcccgtgcctcctgagttc
tggaacaagtcgatgctggagaagccaaccgacgggcgggaggtggtctgccacgcctcg
gcctgggacttctacaacggcaaggacttccggatcaagcagtgcaccaccgtgaacttg
gaggacctggtggtggcccaccacgaaatgggccacatccagtatttcatgcagtacaaa
gacttacctgtggccttgagggagggtgccaaccccggcttccatgaggccattggggac
gtgctagccctctcagtgtctacgcccaagcacctgcacagtctcaacctgctgagcagt
gagggtggcagcgacgagcatgacatcaactttctgatgaagatggcccttgacaagatc
gcctttatccccttcagctacctcgtcgatcagtggcgctggagggtatttgatggaagc
atcaccaaggagaactataaccaggagtggtggagcctcaggctgaagtaccagggcctc
tgccccccagtgcccaggactcaaggtgactttgacccaggggccaagttccacattcct
tctagcgtgccttacatcaggtactttgtcagcttcatcatccagttccagttccacgag
gcactgtgccaggcagctggccacacgggccccctgcacaagtgtgacatctaccagtcc
aaggaggccgggcagcgcctggcgaccgccatgaagctgggcttcagtaggccgtggccg
gaagccatgcagctgatcacgggccagcccaacatgagcgcctcggccatgttgagctac
ttcaagccgctgctggactggctccgcacggagaacgagctgcatggggagaagctgggc
tggccgcagtacaactggacgccgaactccgctcgctcagaagggcccctcccagacagc
ggccgcgtcagcttcctgggcctggacctggatgcgcagcaggcccgcgtgggccagtgg
ctgctgctcttcctgggcatcgccctgctggtagccaccctgggcctcagccagcggctc
ttcagcatccgccaccgcagcctccaccggcactcccacgggccccagttcggctccgag
gtggagctgagacactcctga

DBGET integrated database retrieval system