KEGG   Homo sapiens (human): 2353Help
Entry
2353              CDS       T01001                                 

Gene name
FOS, AP-1, C-FOS, p55
Definition
(RefSeq) Fos proto-oncogene, AP-1 transcription factor subunit
  KO
K04379  proto-oncogene protein c-fos
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04024  cAMP signaling pathway
hsa04210  Apoptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04713  Circadian entrainment
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05031  Amphetamine addiction
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06124  Chemokine signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06224  CXCR signaling
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00509  HTLV-1 Tax to SRF-mediated transcription
N00545  HBV HBx to ERK signaling pathway
N00547  HBV LHBs to PKC-ERK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2353 (FOS)
   04668 TNF signaling pathway
    2353 (FOS)
   04024 cAMP signaling pathway
    2353 (FOS)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    2353 (FOS)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    2353 (FOS)
   04660 T cell receptor signaling pathway
    2353 (FOS)
   04658 Th1 and Th2 cell differentiation
    2353 (FOS)
   04659 Th17 cell differentiation
    2353 (FOS)
   04657 IL-17 signaling pathway
    2353 (FOS)
   04662 B cell receptor signaling pathway
    2353 (FOS)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2353 (FOS)
   04917 Prolactin signaling pathway
    2353 (FOS)
   04921 Oxytocin signaling pathway
    2353 (FOS)
   04926 Relaxin signaling pathway
    2353 (FOS)
   04928 Parathyroid hormone synthesis, secretion and action
    2353 (FOS)
  09156 Nervous system
   04725 Cholinergic synapse
    2353 (FOS)
   04728 Dopaminergic synapse
    2353 (FOS)
  09158 Development
   04380 Osteoclast differentiation
    2353 (FOS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2353 (FOS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2353 (FOS)
   05231 Choline metabolism in cancer
    2353 (FOS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    2353 (FOS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    2353 (FOS)
   05224 Breast cancer
    2353 (FOS)
  09163 Immune disease
   05323 Rheumatoid arthritis
    2353 (FOS)
  09165 Substance dependence
   05031 Amphetamine addiction
    2353 (FOS)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    2353 (FOS)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    2353 (FOS)
   05135 Yersinia infection
    2353 (FOS)
   05133 Pertussis
    2353 (FOS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2353 (FOS)
   05170 Human immunodeficiency virus 1 infection
    2353 (FOS)
   05162 Measles
    2353 (FOS)
   05161 Hepatitis B
    2353 (FOS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    2353 (FOS)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2353 (FOS)
   05142 Chagas disease (American trypanosomiasis)
    2353 (FOS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    2353 (FOS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2353 (FOS)
   04131 Membrane trafficking [BR:hsa04131]
    2353 (FOS)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2353 (FOS)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2353 (FOS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Motif
Other DBs
NCBI-GeneID: 2353
NCBI-ProteinID: NP_005243
OMIM: 164810
HGNC: 3796
Ensembl: ENSG00000170345
Vega: OTTHUMG00000171774
Pharos: P01100(Tbio)
UniProt: P01100 Q6FG41
LinkDB All DBs
Structure
PDB: 

Position
14q24.3
AA seq 380 aa AA seqDB search
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFCTDLAVSSANF
IPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPAPSAGAYSRAGVVKTMTGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFT
LPLLNDPEPKPSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgttctcgggcttcaacgcagactacgaggcgtcatcctcccgctgcagcagcgcg
tccccggccggggatagcctctcttactaccactcacccgcagactccttctccagcatg
ggctcgcctgtcaacgcgcaggacttctgcacggacctggccgtctccagtgccaacttc
attcccacggtcactgccatctcgaccagtccggacctgcagtggctggtgcagcccgcc
ctcgtctcctccgtggccccatcgcagaccagagcccctcaccctttcggagtccccgcc
ccctccgctggggcttactccagggctggcgttgtgaagaccatgacaggaggccgagcg
cagagcattggcaggaggggcaaggtggaacagttatctccagaagaagaagagaaaagg
agaatccgaagggaaaggaataagatggctgcagccaaatgccgcaaccggaggagggag
ctgactgatacactccaagcggagacagaccaactagaagatgagaagtctgctttgcag
accgagattgccaacctgctgaaggagaaggaaaaactagagttcatcctggcagctcac
cgacctgcctgcaagatccctgatgacctgggcttcccagaagagatgtctgtggcttcc
cttgatctgactgggggcctgccagaggttgccaccccggagtctgaggaggccttcacc
ctgcctctcctcaatgaccctgagcccaagccctcagtggaacctgtcaagagcatcagc
agcatggagctgaagaccgagccctttgatgacttcctgttcccagcatcatccaggccc
agtggctctgagacagcccgctccgtgccagacatggacctatctgggtccttctatgca
gcagactgggagcctctgcacagtggctccctggggatggggcccatggccacagagctg
gagcccctgtgcactccggtggtcacctgtactcccagctgcactgcttacacgtcttcc
ttcgtcttcacctaccccgaggctgactccttccccagctgtgcagctgcccaccgcaag
ggcagcagcagcaatgagccttcctctgactcgctcagctcacccacgctgctggccctg
tga

KEGG   Homo sapiens (human): 2354Help
Entry
2354              CDS       T01001                                 

Gene name
FOSB, AP-1, G0S3, GOS3, GOSB
Definition
(RefSeq) FosB proto-oncogene, AP-1 transcription factor subunit
  KO
K09029  protein FosB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    2354 (FOSB)
  09158 Development
   04380 Osteoclast differentiation
    2354 (FOSB)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    2354 (FOSB)
   05031 Amphetamine addiction
    2354 (FOSB)
   05034 Alcoholism
    2354 (FOSB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2354 (FOSB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2354 (FOSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DivIC DUF4407 DUF3450 DUF5082
Motif
Other DBs
NCBI-GeneID: 2354
NCBI-ProteinID: NP_006723
OMIM: 164772
HGNC: 3797
Ensembl: ENSG00000125740
Vega: OTTHUMG00000182122
Pharos: P53539(Tbio)
UniProt: P53539 A0A024R0P6
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 338 aa AA seqDB search
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggctttccccggagactacgactccggctcccggtgcagctcctcaccctct
gccgagtctcaatatctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggttccttcgtgcccacggtcaccgcg
atcacaaccagccaggacctccagtggcttgtgcaacccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcccccggtcgtcgacccctacgacatgccg
ggaaccagctactccacaccaggcatgagtggctacagcagtggcggagcgagtggcagt
ggtgggccttccaccagcggaactaccagtgggcctgggcctgcccgcccagcccgagcc
cggcctaggagaccccgagaggagacgctcaccccagaggaagaggagaagcgaagggtg
cgccgggaacgaaataaactagcagcagctaaatgcaggaaccggcggagggagctgacc
gaccgactccaggcggagacagatcagttggaggaagaaaaagcagagctggagtcggag
atcgccgagctccaaaaggagaaggaacgtctggagtttgtgctggtggcccacaaaccg
ggctgcaagatcccctacgaagaggggcccgggccgggcccgctggcggaggtgagagat
ttgccgggctcagcaccggctaaggaagatggcttcagctggctgctgccgcccccgcca
ccaccgcccctgcccttccagaccagccaagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttaacccttcgtac
acttcttcgtttgtcctcacctgcccggaggtctccgcgttcgccggcgcccaacgcacc
agcggcagtgaccagccttccgatcccctgaactcgccctccctcctcgctctgtga

KEGG   Homo sapiens (human): 2355Help
Entry
2355              CDS       T01001                                 

Gene name
FOSL2, FRA2
Definition
(RefSeq) FOS like 2, AP-1 transcription factor subunit
  KO
K09030  fos-like antigen 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    2355 (FOSL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2355 (FOSL2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2355 (FOSL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf UPF0242 DUF5082 DUF4407
Motif
Other DBs
NCBI-GeneID: 2355
NCBI-ProteinID: NP_005244
OMIM: 601575
HGNC: 3798
Ensembl: ENSG00000075426
Vega: OTTHUMG00000097832
Pharos: P15408(Tbio)
UniProt: P15408 Q9H5M2
LinkDB All DBs
Position
2p23.2
AA seq 326 aa AA seqDB search
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDK
AQRSVIKPISIAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaggattatcccgggaactttgacacctcgtcccggggcagcagcggctctcct
gcgcacgccgagtcctactccagcggcggcggcggccagcagaaattccgggtagatatg
cctggctcaggcagtgcattcatccccaccatcaacgccatcacgaccagccaggacctg
cagtggatggtgcagcccacagtgatcacctccatgtccaacccataccctcgctcgcac
ccctacagccccctgccgggcctggcctctgtccctggacacatggccctcccaagacct
ggcgtgatcaagaccattggcaccaccgtgggccgcaggaggagagatgagcagctgtct
cctgaagaggaggagaagcgtcgcatccggcgggagaggaacaagctggctgcagccaag
tgccggaaccgacgccgggagctgacagagaagctgcaggcggagacagaggagctggag
gaggagaagtcaggcctgcagaaggagattgctgagctgcagaaggagaaggagaagctg
gagttcatgttggtggctcacggcccagtgtgcaagattagccccgaggagcgccgatcg
cccccagcccctgggctgcagcccatgcgcagtgggggtggctcggtgggcgctgtagtg
gtgaaacaggagcccctggaagaggacagcccctcgtcctcgtcggcggggctggacaag
gcccagcgctctgtcatcaagcccatcagcattgctgggggcttctacggtgaggagccc
ctgcacacccccatcgtggtgacctccacacctgctgtcactccgggcacctcgaacctc
gtcttcacctatcctagcgtcctggagcaggagtcacccgcatctccctccgaatcctgc
tccaaggctcaccgcagaagcagtagcagcggggaccaatcatcagactccttgaactcc
cccactctgctggctctgtaa

KEGG   Homo sapiens (human): 3725Help
Entry
3725              CDS       T01001                                 

Gene name
JUN, AP-1, AP1, c-Jun, p39
Definition
(RefSeq) Jun proto-oncogene, AP-1 transcription factor subunit
  KO
K04448  transcription factor AP-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04024  cAMP signaling pathway
hsa04137  Mitophagy - animal
hsa04210  Apoptosis
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05161  Hepatitis B
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05203  Viral carcinogenesis
hsa05210  Colorectal cancer
hsa05211  Renal cell carcinoma
hsa05224  Breast cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06121  TLR signaling (virus)
nt06123  TNF signaling (virus)
nt06124  Chemokine signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06223  TNF-NFKB signaling
nt06224  CXCR signaling
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00189  KSHV K15 to JNK signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00439  HIV Nef to TLR2/4-MAPK signaling pathway
N00446  TNF-JNK signaling pathway
N00447  HIV Vpr/Tat to TNF-JNK signaling pathway
N00503  HTLV-1 Tax to TNF-JNK signaling pathway
N00543  HBV HBx to JNK signaling pathway
N00545  HBV HBx to ERK signaling pathway
N00547  HBV LHBs to PKC-ERK signaling pathway
N00551  HBV HBs to TLR2/4-MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3725 (JUN)
   04012 ErbB signaling pathway
    3725 (JUN)
   04310 Wnt signaling pathway
    3725 (JUN)
   04668 TNF signaling pathway
    3725 (JUN)
   04024 cAMP signaling pathway
    3725 (JUN)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    3725 (JUN)
  09143 Cell growth and death
   04210 Apoptosis
    3725 (JUN)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3725 (JUN)
   04530 Tight junction
    3725 (JUN)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3725 (JUN)
   04621 NOD-like receptor signaling pathway
    3725 (JUN)
   04625 C-type lectin receptor signaling pathway
    3725 (JUN)
   04660 T cell receptor signaling pathway
    3725 (JUN)
   04658 Th1 and Th2 cell differentiation
    3725 (JUN)
   04659 Th17 cell differentiation
    3725 (JUN)
   04657 IL-17 signaling pathway
    3725 (JUN)
   04662 B cell receptor signaling pathway
    3725 (JUN)
  09152 Endocrine system
   04912 GnRH signaling pathway
    3725 (JUN)
   04915 Estrogen signaling pathway
    3725 (JUN)
   04921 Oxytocin signaling pathway
    3725 (JUN)
   04926 Relaxin signaling pathway
    3725 (JUN)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    3725 (JUN)
  09158 Development
   04380 Osteoclast differentiation
    3725 (JUN)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3725 (JUN)
   05203 Viral carcinogenesis
    3725 (JUN)
   05231 Choline metabolism in cancer
    3725 (JUN)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3725 (JUN)
  09162 Cancer: specific types
   05210 Colorectal cancer
    3725 (JUN)
   05211 Renal cell carcinoma
    3725 (JUN)
   05224 Breast cancer
    3725 (JUN)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3725 (JUN)
   05321 Inflammatory bowel disease (IBD)
    3725 (JUN)
  09165 Substance dependence
   05030 Cocaine addiction
    3725 (JUN)
   05031 Amphetamine addiction
    3725 (JUN)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3725 (JUN)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3725 (JUN)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3725 (JUN)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    3725 (JUN)
   05132 Salmonella infection
    3725 (JUN)
   05135 Yersinia infection
    3725 (JUN)
   05133 Pertussis
    3725 (JUN)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3725 (JUN)
   05170 Human immunodeficiency virus 1 infection
    3725 (JUN)
   05162 Measles
    3725 (JUN)
   05161 Hepatitis B
    3725 (JUN)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3725 (JUN)
   05169 Epstein-Barr virus infection
    3725 (JUN)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    3725 (JUN)
   05142 Chagas disease (American trypanosomiasis)
    3725 (JUN)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    3725 (JUN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3725 (JUN)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3725 (JUN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Fib_alpha Jnk-SapK_ap_N FlaC_arch NBP1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 3725
NCBI-ProteinID: NP_002219
OMIM: 165160
HGNC: 6204
Ensembl: ENSG00000177606
Vega: OTTHUMG00000008376
Pharos: P05412(Tchem)
UniProt: P05412
LinkDB All DBs
Structure
PDB: 

Position
1p32.1
AA seq 331 aa AA seqDB search
MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETP
PLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANM
LREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctatgacgatgccctcaacgcctcgttcctcccg
tccgagagcggaccttatggctacagtaaccccaagatcctgaaacagagcatgaccctg
aacctggccgacccagtggggagcctgaagccgcacctccgcgccaagaactcggacctc
ctcacctcgcccgacgtggggctgctcaagctggcgtcgcccgagctggagcgcctgata
atccagtccagcaacgggcacatcaccaccacgccgacccccacccagttcctgtgcccc
aagaacgtgacagatgagcaggagggcttcgccgagggcttcgtgcgcgccctggccgaa
ctgcacagccagaacacgctgcccagcgtcacgtcggcggcgcagccggtcaacggggca
ggcatggtggctcccgcggtagcctcggtggcagggggcagcggcagcggcggcttcagc
gccagcctgcacagcgagccgccggtctacgcaaacctcagcaacttcaacccaggcgcg
ctgagcagcggcggcggggcgccctcctacggcgcggccggcctggcctttcccgcgcaa
ccccagcagcagcagcagccgccgcaccacctgccccagcagatgcccgtgcagcacccg
cggctgcaggccctgaaggaggagcctcagacagtgcccgagatgcccggcgagacaccg
cccctgtcccccatcgacatggagtcccaggagcggatcaaggcggagaggaagcgcatg
aggaaccgcatcgctgcctccaagtgccgaaaaaggaagctggagagaatcgcccggctg
gaggaaaaagtgaaaaccttgaaagctcagaactcggagctggcgtccacggccaacatg
ctcagggaacaggtggcacagcttaaacagaaagtcatgaaccacgttaacagtgggtgc
caactcatgctaacgcagcagttgcaaacattttga

KEGG   Homo sapiens (human): 3726Help
Entry
3726              CDS       T01001                                 

Gene name
JUNB, AP-1
Definition
(RefSeq) JunB proto-oncogene, AP-1 transcription factor subunit
  KO
K09028  transcription factor jun-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04668  TNF signaling pathway
Disease
H01463  Mycosis fungoides
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    3726 (JUNB)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    3726 (JUNB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3726 (JUNB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3726 (JUNB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf Jnk-SapK_ap_N ZapB PspA_IM30 MAD DUF737
Motif
Other DBs
NCBI-GeneID: 3726
NCBI-ProteinID: NP_002220
OMIM: 165161
HGNC: 6205
Ensembl: ENSG00000171223
Vega: OTTHUMG00000180373
Pharos: P17275(Tbio)
UniProt: P17275 Q5U079
LinkDB All DBs
Position
19p13.13
AA seq 347 aa AA seqDB search
MCTKMEQPFYHDDSYTATGYGRAPGGLSLHDYKLLKPSLAVNLADPYRSLKAPGARGPGP
EGGGGGSYFSGQGSDTGASLKLASSELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
AGGAGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGATGGPPAGPGGVYAGPEPPP
VYTNLSSYSPASASSGGAGAAVGTGSSYPTTTISYLPHAPPFAGGHPAQLGLGRGASTFK
EEPQTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKV
KTLKAENAGLSSTAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtgcactaaaatggaacagcccttctaccacgacgactcatacacagctacgggatac
ggccgggcccctggtggcctctctctacacgactacaaactcctgaaaccgagcctggcg
gtcaacctggccgacccctaccggagtctcaaagcgcctggggctcgcggacccggccca
gagggcggcggtggcggcagctacttttctggtcagggctcggacaccggcgcgtctctc
aagctcgcctcttcggagctggaacgcctgattgtccccaacagcaacggcgtgatcacg
acgacgcctacacccccgggacagtacttttacccccgcgggggtggcagcggtggaggt
gcagggggcgcagggggcggcgtcaccgaggagcaggagggcttcgccgacggctttgtc
aaagccctggacgatctgcacaagatgaaccacgtgacaccccccaacgtgtccctgggc
gctaccggggggcccccggctgggcccgggggcgtctacgccggcccggagccacctccc
gtttacaccaacctcagcagctactccccagcctctgcgtcctcgggaggcgccggggct
gccgtcgggaccgggagctcgtacccgacgaccaccatcagctacctcccacacgcgccg
cccttcgccggtggccacccggcgcagctgggcttgggccgcggcgcctccaccttcaag
gaggaaccgcagaccgtgccggaggcgcgcagccgggacgccacgccgccggtgtccccc
atcaacatggaagaccaagagcgcatcaaagtggagcgcaagcggctgcggaaccggctg
gcggccaccaagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtg
aagacgctcaaggccgagaacgcggggctgtcgagtaccgccggcctcctccgggagcag
gtggcccagctcaaacagaaggtcatgacccacgtcagcaacggctgtcagctgctgctt
ggggtcaagggacacgccttctga

KEGG   Homo sapiens (human): 3727Help
Entry
3727              CDS       T01001                                 

Gene name
JUND, AP-1
Definition
(RefSeq) JunD proto-oncogene, AP-1 transcription factor subunit
  KO
K04449  transcription factor jun-D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    3727 (JUND)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    3727 (JUND)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    3727 (JUND)
  09158 Development
   04380 Osteoclast differentiation
    3727 (JUND)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3727 (JUND)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    3727 (JUND)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB TSC22 Jnk-SapK_ap_N DUF3450 FlaC_arch Fib_alpha TEX13
Motif
Other DBs
NCBI-GeneID: 3727
NCBI-ProteinID: NP_005345
OMIM: 165162
HGNC: 6206
Ensembl: ENSG00000130522
Vega: OTTHUMG00000183355
Pharos: P17535(Tbio)
UniProt: P17535
LinkDB All DBs
Structure
PDB: 

Position
19p13.11
AA seq 347 aa AA seqDB search
METPFYGDEALSGLGGGASGSGGSFASPGRLFPGAPPTAAAGSMMKKDALTLSLSEQVAA
ALKPAAAPPPTPLRADGAPSAAPPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
SQFLYPKVAASEEQEFAEGFVKALEDLHKQNQLGAGAAAAAAAAAAGGPSGTATGSAPPG
ELAPAAAAPEAPVYANLSSYAGGAGGAGGAATVAFAAEPVPFPPPPPPGALGPPRLAALK
DEPQTVPDVPSFGESPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKV
KTLKSQNTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggaaacacccttctacggcgatgaggcgctgagcggcctgggcggcggcgccagtggc
agcggcggcagcttcgcgtccccgggccgcttgttccccggggcgcccccgacggccgcg
gccggcagcatgatgaagaaggacgcgctgacgctgagcctgagtgagcaggtggcggca
gcgctcaagcctgcggccgcgccgcctcctacccccctgcgcgccgacggcgcccccagc
gcggcaccccccgacggcctgctcgcctctcccgacctggggctgctgaagctggcctcc
cccgagctcgagcgcctcatcatccagtccaacgggctggtcaccaccacgccgacgagc
tcacagttcctctaccccaaggtggcggccagcgaggagcaggagttcgccgagggcttc
gtcaaggccctggaggatttacacaagcagaaccagctcggcgcgggcgcggccgctgcc
gccgccgccgccgccgccggggggccctcgggcacggccacgggctccgcgccccccggc
gagctggccccggcggcggccgcgcccgaagcgcctgtctacgcgaacctgagcagctac
gcgggcggcgccgggggcgcggggggcgccgcgacggtcgccttcgctgccgaacctgtg
cccttcccgccgccgccacccccaggcgcgttggggccgccgcgcctggctgcgctcaag
gacgagccacagacggtgcccgacgtgccgagcttcggcgagagcccgccgttgtcgccc
atcgacatggacacgcaggagcgcatcaaggcggagcgcaagcggctgcgcaaccgcatc
gccgcctccaagtgccgcaagcgcaagctggagcgcatctcgcgcctggaagagaaagtg
aagaccctcaagagtcagaacacggagctggcgtccacggcgagcctgctgcgcgagcag
gtggcgcagctcaagcagaaagtcctcagccacgtcaacagcggctgccagctgctgccc
cagcaccaggtgcccgcgtactga

KEGG   Homo sapiens (human): 8061Help
Entry
8061              CDS       T01001                                 

Gene name
FOSL1, FRA, FRA1, fra-1
Definition
(RefSeq) FOS like 1, AP-1 transcription factor subunit
  KO
K04502  fos-like antigen 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00509  HTLV-1 Tax to SRF-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8061 (FOSL1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    8061 (FOSL1)
  09158 Development
   04380 Osteoclast differentiation
    8061 (FOSL1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    8061 (FOSL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8061 (FOSL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    8061 (FOSL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 Siah-Interact_N HALZ Macoilin DUF4407 UPF0242
Motif
Other DBs
NCBI-GeneID: 8061
NCBI-ProteinID: NP_005429
OMIM: 136515
HGNC: 13718
Ensembl: ENSG00000175592
Vega: OTTHUMG00000166715
Pharos: P15407(Tbio)
UniProt: P15407 A0A0S2Z595
LinkDB All DBs
Position
11q13.1
AA seq 271 aa AA seqDB search
MFRDFGEPGPSSGNGGGYGGPAQPPAAAQAAQQKFHLVPSINTMSGSQELQWMVQPHFLG
PSSYPRPLTYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGAKE
GDTGSTSGTSSPPAPCRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYPST
PEPCASAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgttccgagacttcggggaacccggcccgagctccgggaacggcggcgggtacggcggc
cccgcgcagcccccggccgcagcgcaggcagcccagcagaagttccacctggtgccaagc
atcaacaccatgagtggcagtcaggagctgcagtggatggtacagcctcatttcctgggg
cccagcagttaccccaggcctctgacctaccctcagtacagccccccacaaccccggcca
ggagtcatccgggccctggggccgcctccaggggtacgtcgaaggccttgtgaacagatc
agcccggaggaagaggagcgccgccgagtaaggcgcgagcggaacaagctggctgcggcc
aagtgcaggaaccggaggaaggaactgaccgacttcctgcaggcggagactgacaaactg
gaagatgagaaatctgggctgcagcgagagattgaggagctgcagaagcagaaggagcgc
ctagagctggtgctggaagcccaccgacccatctgcaaaatcccggaaggagccaaggag
ggggacacaggcagtaccagtggcaccagcagcccaccagccccctgccgccctgtacct
tgtatctccctttccccagggcctgtgcttgaacctgaggcactgcacacccccacactc
atgaccacaccctccctaactcctttcacccccagcctggtcttcacctaccccagcact
cctgagccttgtgcctcagctcatcgcaagagtagcagcagcagcggagacccatcctct
gacccccttggctctccaaccctcctcgctttgtga

DBGET integrated database retrieval system