KEGG   Homo sapiens (human): 5747
Entry
5747              CDS       T01001                                 

Gene name
PTK2, FADK, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04935  Growth hormone synthesis, secretion and action
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01083  Shigella OspE to ITGA/B-TALIN/VINCULIN signaling pathway
N01111  Yersinia YopH to ITGA/B-FAK-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    5747 (PTK2)
   04370 VEGF signaling pathway
    5747 (PTK2)
   04151 PI3K-Akt signaling pathway
    5747 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5747 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5747 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5747 (PTK2)
   04062 Chemokine signaling pathway
    5747 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    5747 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    5747 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5747 (PTK2)
   05202 Transcriptional misregulation in cancer
    5747 (PTK2)
   05205 Proteoglycans in cancer
    5747 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    5747 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5747 (PTK2)
   05163 Human cytomegalovirus infection
    5747 (PTK2)
   05165 Human papillomavirus infection
    5747 (PTK2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5747 (PTK2)
   05135 Yersinia infection
    5747 (PTK2)
   05100 Bacterial invasion of epithelial cells
    5747 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5747 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5747 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5747 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5747 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5747 (PTK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5747 (PTK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FAK family
   5747 (PTK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5747 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 5747
NCBI-ProteinID: NP_722560
OMIM: 600758
HGNC: 9611
Ensembl: ENSG00000169398
Vega: OTTHUMG00000067438
Pharos: Q05397(Tchem)
UniProt: Q05397 Q658W2 Q59GM6
LinkDB
Structure
PDB: 

Position
8q24.3
AA seq 1052 aa
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggcagctgcttaccttgaccccaacttgaatcacacaccaaattcgagtactaagact
cacctgggtactggtatggaacgttctcctggtgcaatggagcgagtattaaaggtcttt
cattattttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gatatgggcgtctccagtgtgagggagaagtatgagcttgctcacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gatcaagtggaccaggaaattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacaaacatttagacaatttgccaaccttaatagagaagaaagtatt
ctgaaattctttgagatcctgtctccagtctacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcactcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcggagaatatg
gctgacctaatagatgggtactgccggctggtgaatggaacctcgcagtcatttatcatc
agacctcagaaagaaggtgaacgggctttgccatcaataccaaagttggccaacagcgaa
aagcaaggcatgcggacacacgccgtctctgtgtcagaaacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcatt
tatatgagtccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagtacagctcttgcatatctagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagagcgcatgaggatggagtccagaagacaggccaca
gtgtcctgggactccggagggtctgatgaagcaccgcccaagcccagcagaccgggttat
cccagtccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaat
cattaccaggtttctggctaccctggttcacatggaatcacagccatggctggcagcatc
tatccaggtcaggcatctcttttggaccaaacagattcatggaatcatagacctcaggag
atagcaatgtggcagcccaatgtggaggactctacagtattggacctgcgagggattggg
caagtgttgccaacccatctgatggaagagcgtctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccagatcctgcagctccaccaaagaaaccgcctcgccctgga
gctcccggtcatctgggaagccttgccagcctcagcagccctgctgacagctacaacgag
ggtgtcaagcttcagccccaggaaatcagcccccctcctactgccaacctggaccggtcg
aatgataaggtgtacgagaatgtgacgggcctggtgaaagctgtcatcgagatgtccagt
aaaatccagccagccccaccagaggagtatgtccctatggtgaaggaagtcggcttggcc
ctgaggacattattggccactgtggatgagaccattcccctcctaccagccagcacccac
cgagagattgagatggcacagaagctattgaactctgacctgggtgagctcatcaacaag
atgaaactggcccagcagtatgtcatgaccagcctccagcaagagtacaaaaagcaaatg
ctgactgctgctcacgccctggctgtggatgccaaaaacttactcgatgtcattgaccaa
gcaagactgaaaatgcttgggcagacgagaccacactga

KEGG   Homo sapiens (human): 9564
Entry
9564              CDS       T01001                                 

Gene name
BCAR1, CAS, CAS1, CASS1, CRKAS, P130Cas
Definition
(RefSeq) BCAR1 scaffold protein, Cas family member
  KO
K05726  breast cancer anti-estrogen resistance 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04935  Growth hormone synthesis, secretion and action
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01110  Yersinia YopH to ITGA/B-FAK-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9564 (BCAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    9564 (BCAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9564 (BCAR1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    9564 (BCAR1)
   04062 Chemokine signaling pathway
    9564 (BCAR1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    9564 (BCAR1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    9564 (BCAR1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    9564 (BCAR1)
   05135 Yersinia infection
    9564 (BCAR1)
   05100 Bacterial invasion of epithelial cells
    9564 (BCAR1)
SSDB
Motif
Pfam: CAS_C Serine_rich SH3_1 SH3_9 SH3_2 Vinculin
Other DBs
NCBI-GeneID: 9564
NCBI-ProteinID: NP_001164189
OMIM: 602941
HGNC: 971
Ensembl: ENSG00000050820
Vega: OTTHUMG00000137604
Pharos: P56945(Tbio)
UniProt: P56945
LinkDB
Structure
PDB: 
1WYX 3T6G 5O2M 5O2P 5O2Q

Position
16q23.1
AA seq 870 aa
MSVPNVLAKALYDNVAESPDELSFRKGDIMTVLEQDTQGLDGWWLCSLHGRQGIVPGNRL
KILVGMYDKKPAGPGPGPPATPAQPQPGLHAPAPPASQYTPMLPNTYQPQPDSVYLVPTP
SKAQQGLYQVPGPSPQFQSPPAKQTSTFSKQTPHHPFPSPATDLYQVPPGPGGPAQDIYQ
VPPSAGMGHDIYQVPPSMDTRSWEGTKPPAKVVVPTRVGQGYVYEAAQPEQDEYDIPRHL
LAPGPQDIYDVPPVRGLLPSQYGQEVYDTPPMAVKGPNGRDPLLEVYDVPPSVEKGLPPS
NHHAVYDVPPSVSKDVPDGPLLREETYDVPPAFAKAKPFDPARTPLVLAAPPPDSPPAED
VYDVPPPAPDLYDVPPGLRRPGPGTLYDVPRERVLPPEVADGGVVDSGVYAVPPPAEREA
PAEGKRLSASSTGSTRSSQSASSLEVAGPGREPLELEVAVEALARLQQGVSATVAHLLDL
AGSAGATGSWRSPSEPQEPLVQDLQAAVAAVQSAVHELLEFARSAVGNAAHTSDRALHAK
LSRQLQKMEDVHQTLVAHGQALDAGRGGSGATLEDLDRLVACSRAVPEDAKQLASFLHGN
ASLLFRRTKATAPGPEGGGTLHPNPTDKTSSIQSRPLPSPPKFTSQDSPDGQYENSEGGW
MEDYDYVHLQGKEEFEKTQKELLEKGSITRQGKSQLELQQLKQFERLEQEVSRPIDHDLA
NWTPAQPLAPGRTGGLGPSDRQLLLFYLEQCEANLTTLTNAVDAFFTAVATNQPPKIFVA
HSKFVILSAHKLVFIGDTLSRQAKAADVRSQVTHYSNLLCDLLRGIVATTKAAALQYPSP
SAAQDMVERVKELGHSTQQFRRVLGQLAAA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgtccgtgcctaacgtgctggccaaagcgctctatgacaatgtggccgagtccccggat
gagctctccttccgcaagggtgacatcatgacggtgctggagcaggacacgcagggcctg
gacggctggtggctctgctcgctgcatgggcgccagggcatcgtgcctgggaaccgcctc
aagatcttggtgggcatgtatgataagaagccagcagggcctggccccggccctcccgcc
accccggcccagcctcagcctggcctccatgccccagcgcctccggcctcccagtacacg
cccatgctccccaacacctaccagccccagccagacagcgtctacctggtgcccactccc
agcaaggctcagcaaggcctctaccaagtcccgggtcccagccctcagttccagtctccc
ccagccaagcagacatccaccttctcgaagcagacaccccatcacccgtttcccagcccg
gccacagacctgtaccaggtgcccccagggcctggaggccctgcccaggatatttaccag
gtgccaccttctgccgggatggggcatgacatctaccaggtccccccgtccatggacaca
cgcagctgggagggcacgaagcccccggcaaaggtggtggtgcccacccgcgtggggcag
ggctatgtatacgaggccgcccagccggagcaggacgagtacgacatcccgcgacacctg
ctggccccggggccacaggacatctatgatgtgcccccggttcgggggctgcttcccagc
cagtatggccaggaggtgtatgacacaccccccatggctgtcaagggtcccaatggccga
gacccgttgctggaggtgtatgacgtgccccccagtgtggagaagggcctgccaccgtcc
aaccaccacgcagtctacgacgttcctccatcggtgagcaaggatgtgcccgatggccca
ctgctgcgtgaggagacctacgatgtgccccccgccttcgccaaggccaagccctttgac
ccggcccgcaccccactggtactggctgcgccccctccagactccccgccggccgaggac
gtgtatgacgtgccgcccccggctcctgacctctacgacgtgccccctggcttgcggcgg
cctggcccgggcaccctgtacgatgtgccccgtgaacgggtgcttcctcctgaggtggct
gatggtggcgtggtcgacagtggtgtgtatgcggtgcctcccccagctgaacgtgaagcc
ccggcagagggcaagcgcctgtcggcctccagcaccggcagcacacgcagcagccagtct
gcgtcctccttggaggtggcagggccgggccgggaacccctggagctggaagttgctgtg
gaggccctggcacggctgcagcagggtgtgagcgccaccgttgcccaccttctggacctg
gcaggcagcgccggtgcgactgggagctggcgtagcccctctgagccacaggagccgctg
gtgcaggacctgcaggctgctgtggccgctgtccagagtgccgtccacgagctgttggag
tttgcccgcagcgcggtgggcaatgctgcccacacatctgaccgtgccctgcatgccaag
cttagccggcagctgcagaagatggaggacgtgcaccagacgctggtggcacatggtcag
gccctcgacgctggccggggaggctctggagccacccttgaggacctggaccggctggtg
gcctgctcgcgggctgtgcccgaggacgccaagcagctggcctccttcctgcacggcaat
gcctcactgctcttcagacggaccaaggccactgccccggggcctgaggggggtggcacc
ctgcaccccaaccccactgacaagaccagcagcatccagtcacgacccctgccctcaccc
cctaagttcacctcccaggactcgccagatgggcagtacgagaacagcgaggggggctgg
atggaggactatgactacgtccacctacaggggaaggaggagtttgagaagacccagaag
gagctgctggaaaagggcagcatcacgcggcagggcaagagccagctggagttgcagcag
ctgaagcagtttgaacgactggaacaggaggtgtcacggcccatagaccacgacctggcc
aactggacgccagcccaacccctggccccggggcgaacaggcggcctggggccctcggac
cggcagctgctgctcttctacctggagcagtgtgaggccaacctgaccacactgaccaac
gccgtggacgccttctttaccgccgtggccaccaaccagccgcccaagatctttgtggcg
cacagcaagttcgtcatcctcagcgcccacaagctggtgttcatcggggacacactgtca
cggcaggccaaggctgctgacgtgcgcagccaggtgacccactacagcaacctgctgtgc
gacctcctgcgcggcatcgtggccaccaccaaggccgctgccttgcagtacccatcgcct
tccgcggcccaggacatggtggagagggtcaaggagctgggccacagcacccagcagttc
cgccgcgtcctaggccagctggcagccgcctga

KEGG   Homo sapiens (human): 1398
Entry
1398              CDS       T01001                                 

Gene name
CRK, CRKII, p38
Definition
(RefSeq) CRK proto-oncogene, adaptor protein
  KO
K04438  C-crk adapter molecule crk
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04510  Focal adhesion
hsa04666  Fc gamma R-mediated phagocytosis
hsa04722  Neurotrophin signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa04910  Insulin signaling pathway
hsa04935  Growth hormone synthesis, secretion and action
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05220  Chronic myeloid leukemia
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
nt06214  PI3K signaling
nt06276  Chronic myeloid leukemia
  Element
N00048  BCR-ABL fusion kinase to PI3K signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01090  IGG-FCGR-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1398 (CRK)
   04012 ErbB signaling pathway
    1398 (CRK)
   04015 Rap1 signaling pathway
    1398 (CRK)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    1398 (CRK)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1398 (CRK)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    1398 (CRK)
   04062 Chemokine signaling pathway
    1398 (CRK)
  09152 Endocrine system
   04910 Insulin signaling pathway
    1398 (CRK)
   04935 Growth hormone synthesis, secretion and action
    1398 (CRK)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    1398 (CRK)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1398 (CRK)
   05206 MicroRNAs in cancer
    1398 (CRK)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    1398 (CRK)
   05211 Renal cell carcinoma
    1398 (CRK)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    1398 (CRK)
   05163 Human cytomegalovirus infection
    1398 (CRK)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    1398 (CRK)
   05135 Yersinia infection
    1398 (CRK)
   05100 Bacterial invasion of epithelial cells
    1398 (CRK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    1398 (CRK)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Other SH2 and SH3-containing proteins
   1398 (CRK)
SSDB
Motif
Pfam: SH3_2 SH2 SH3_1 SH3_9 SH3_10 DUF3804
Other DBs
NCBI-GeneID: 1398
NCBI-ProteinID: NP_058431
OMIM: 164762
HGNC: 2362
Ensembl: ENSG00000167193
Vega: OTTHUMG00000090317
Pharos: P46108(Tbio)
UniProt: P46108 A0A0S2Z3Q4 L7RT18
LinkDB
Structure
PDB: 

Position
17p13.3
AA seq 304 aa
MAGNFDSEERSSWYWGRLSRQEAVALLQGQRHGVFLVRDSSTSPGDYVLSVSENSRVSHY
IINSSGPRPPVPPSPAQPPPGVSPSRLRIGDQEFDSLPALLEFYKIHYLDTTTLIEPVSR
SRQGSGVILRQEEAEYVRALFDFNGNDEEDLPFKKGDILRIRDKPEEQWWNAEDSEGKRG
MIPVPYVEKYRPASASVSALIGGNQEGSHPQPLGGPEPGPYAQPSVNTPLPNLQNGPIYA
RVIQKRVPNAYDKTALALEVGELVKVTKINVSGQWEGECNGKRGHFPFTHVRLLDQQNPD
EDFS
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcgggcaacttcgactcggaggagcggagtagctggtactgggggaggttgagtcgg
caggaggcggtggcgctgctgcagggccagcggcacggggtgttcctggtgcgggactcg
agcaccagccccggggactatgtgctcagcgtctcagagaactcgcgcgtctcccactac
atcatcaacagcagcggcccgcgcccgccggtgccaccgtcgcccgcccagcctccgccc
ggggtgagcccctccagactccgaataggagatcaagagtttgattcattgcctgcttta
ctggaattctacaaaatacactatttggacactacaacgttgatagaaccagtttccaga
tccaggcagggtagtggagtgattctcaggcaggaggaggcggagtatgtgcgagccctc
tttgactttaatgggaatgatgaggaagatcttccctttaagaaaggagacatcttgaga
atccgggacaagcctgaagagcagtggtggaatgcggaggacagcgaaggcaagagaggg
atgattccagtcccttacgtcgagaagtatagacctgcctccgcctcagtatcggctctg
attggaggtaaccaggagggttcccacccacagccactgggtgggccggagcctgggccc
tatgcccaacccagcgtcaacactccgctccctaacctccagaatgggcccatatatgcc
agggttatccagaagcgagtccccaatgcctacgacaagacagccttggctttggaggtc
ggtgagctggtaaaggttacgaagattaatgtgagtggtcagtgggaaggggagtgtaat
ggcaaacgaggtcacttcccattcacacatgtccgtctgctggatcaacagaatcccgat
gaggacttcagctga

KEGG   Homo sapiens (human): 5829
Entry
5829              CDS       T01001                                 

Gene name
PXN
Definition
(RefSeq) paxillin
  KO
K05760  paxillin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01083  Shigella OspE to ITGA/B-TALIN/VINCULIN signaling pathway
N01109  Yersinia YopH to ITGA/B-FAK-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    5829 (PXN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5829 (PXN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5829 (PXN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5829 (PXN)
   04062 Chemokine signaling pathway
    5829 (PXN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    5829 (PXN)
   05203 Viral carcinogenesis
    5829 (PXN)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5829 (PXN)
   05163 Human cytomegalovirus infection
    5829 (PXN)
   05165 Human papillomavirus infection
    5829 (PXN)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5829 (PXN)
   05135 Yersinia infection
    5829 (PXN)
   05100 Bacterial invasion of epithelial cells
    5829 (PXN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    5829 (PXN)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  Paxillin family proteins
   5829 (PXN)
SSDB
Motif
Pfam: Paxillin LIM
Other DBs
NCBI-GeneID: 5829
NCBI-ProteinID: NP_001074324
OMIM: 602505
HGNC: 9718
Ensembl: ENSG00000089159
Vega: OTTHUMG00000169169
Pharos: P49023(Tbio)
UniProt: P49023 A0A140VJQ8
LinkDB
Structure
PDB: 
2VZG 4EDN 6U4M 6U4N 2VZD

Position
12q24.23
AA seq 591 aa
MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNG
TILDPLDQWQPSSSRFIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSF
PNKQKSAEPSPTVMSTSLGSNLSELDRLLLELNAVQHNPPGFPADEANSSPPLPGALSPL
YGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELESSVPSPVPAITVNQG
EMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGA
CKKPIAGQVVTAMGKTWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYC
NGPILDKVVTALDRTWHPEHFFCAQCGAFFGPEGFHEKDGKAYCRKDYFDMFAPKCGGCA
RAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEVHYHERRGSLCSGCQK
PITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggacgacctcgacgccctgctggcggacttggagtctaccacctcccacatctccaaa
cggcctgtgttcttgtcggaggagaccccctactcatacccaactggaaaccacacatac
caggagattgccgtgccaccccccgtccccccacccccgtccagcgaggccctcaatggc
acaatccttgaccccttagaccagtggcagcccagcagctcccgattcatccaccagcag
cctcagtcctcatcacctgtgtacggctccagtgccaaaacttccagtgtctccaaccct
caggacagtgttggctctccgtgctcccgagtgggtgaggaggagcacgtctacagcttc
cccaacaagcagaaatcagctgagccttcacccaccgtaatgagcacgtccctgggcagc
aacctttctgaactcgaccgcctgctgctggaactgaacgctgtacagcataacccgcca
ggcttccctgcagatgaggccaactcaagccccccgcttcctggggccctgagccccctc
tatggtgtcccagagactaacagccccttgggaggcaaagctgggcccctgacgaaagag
aagcctaagcggaatgggggccggggcctggaggacgtgcggcccagtgtggagagtctc
ttggatgaactggagagctccgtgcccagccccgtccctgccatcactgtgaaccagggc
gagatgagcagcccgcagcgcgtcacctccacccaacagcagacacgcatctcggcctcc
tctgccaccagggagctggacgagctgatggcttcgctgtcggatttcaagatccagggc
ctggagcaaagagcggatggggagcggtgctgggcggccggctggcctcgggacggcggg
cggagcagccccggagggcaggacgagggagggttcatggcccaggggaagacagggagc
agctcaccccctggggggcccccgaagcccgggagccagctggacagcatgctggggagc
ctgcagtctgacctgaacaagctgggggtcgccacagtcgccaaaggagtctgcggggcc
tgcaagaagcccatcgccgggcaggttgtgaccgccatggggaagacgtggcaccccgag
cacttcgtctgcacccactgccaggaggagatcggatcccggaacttcttcgagcgggat
ggacagccctactgtgaaaaggactaccacaacctcttctccccgcgctgctactactgc
aacggccccatcctggataaagtggtgacagcccttgaccggacgtggcaccctgaacac
ttcttctgtgcacagtgtggagccttctttggtcccgaagggttccacgagaaggacggc
aaggcctactgtcgcaaggactacttcgacatgttcgcacccaagtgtggcggctgcgcc
cgggccatcctggagaactatatctcagccctcaacacgctgtggcatcctgagtgcttt
gtgtgccgggaatgcttcacgccattcgtgaacggcagcttcttcgagcacgacgggcag
ccctactgtgaggtgcactaccacgagcggcgcggctcgctgtgttctggctgccagaag
cccatcaccggccgctgcatcaccgccatggccaagaagttccaccccgagcacttcgtc
tgtgccttctgcctcaagcagctcaacaagggcaccttcaaggagcagaacgacaagcct
tactgtcagaactgcttcctcaagctcttctgctag

DBGET integrated database retrieval system