KEGG   Homo sapiens (human): 7153
Entry
7153              CDS       T01001                                 

Gene name
TOP2A, TOP2, TP2A
Definition
(RefSeq) DNA topoisomerase II alpha
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
Drug target
Aclarubicin (DG00699): D01911<JP> D02756
Aldoxorubicin (DG01726): D10383 D10384
Amonafide (DG01268): D10090 D10091
Amrubicin (DG00703): D07100<JP> D08854
Amsacrine: D02321
Becatecarin: D03220
Berubicin hydrochloride: D08871
Crisnatol mesylate: D03602
Daunorubicin (DG00697): D01264<JP/US> D07776 D10787
Dexrazoxane (DG01162): D03730<JP> D07807<US>
Doxorubicin (DG00696): D01275<JP/US> D03899
Elsamitrucin: D03977
Epirubicin (DG00698): D02214<JP/US> D07901
Etoposide (DG00693): D00125<JP/US> D04107<US>
Fostriecin sodium: D04262
Idarubicin (DG00700): D01747<JP/US> D08062
Idronoxil: D04498
Ledoxantrone trihydrochloride: D04685
Losoxantrone hydrochloride: D04783
Menogaril: D04914
Mitindomide: D05054
Mitoxantrone (DG00701): D02166<JP/US> D08224
Pirarubicin (DG00702): D01885 D08386<JP>
Piroxantrone hydrochloride: D05510
Pixantrone (DG00704): D05522 D09654
Quarfloxin: D08981
Sobuzoxane: D01404<JP>
Teloxantrone hydrochloride: D06059
Teniposide: D02698<US>
Tirapazamine: D06167
Topixantrone: D06190
Valrubicin: D02697<US>
Vosaroxin: D08024
Zorubicin: D06386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    7153 (TOP2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7153 (TOP2A)
   03036 Chromosome and associated proteins [BR:hsa03036]
    7153 (TOP2A)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     7153 (TOP2A)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Topoisomerases
   7153 (TOP2A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    7153 (TOP2A)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    7153 (TOP2A)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim Filaggrin
Other DBs
NCBI-GeneID: 7153
NCBI-ProteinID: NP_001058
OMIM: 126430
HGNC: 11989
Ensembl: ENSG00000131747
Vega: OTTHUMG00000155008
Pharos: P11388(Tclin)
UniProt: P11388
LinkDB
Structure
PDB: 
1ZXM 4R1F 1ZXN 4FM9 5GWK

Position
17q21.2
AA seq 1531 aa
MEVSPLQPVNENMQVNKIKKNEDAKKRLSVERIYQKKTQLEHILLRPDTYIGSVELVTQQ
MWVYDEDVGINYREVTFVPGLYKIFDEILVNAADNKQRDPKMSCIRVTIDPENNLISIWN
NGKGIPVVEHKVEKMYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVE
TASREYKKMFKQTWMDNMGRAGEMELKPFNGEDYTCITFQPDLSKFKMQSLDKDIVALMV
RRAYDIAGSTKDVKVFLNGNKLPVKGFRSYVDMYLKDKLDETGNSLKVIHEQVNHRWEVC
LTMSEKGFQQISFVNSIATSKGGRHVDYVADQIVTKLVDVVKKKNKGGVAVKAHQVKNHM
WIFVNALIENPTFDSQTKENMTLQPKSFGSTCQLSEKFIKAAIGCGIVESILNWVKFKAQ
VQLNKKCSAVKHNRIKGIPKLDDANDAGGRNSTECTLILTEGDSAKTLAVSGLGVVGRDK
YGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDEDSLKTLRYGKIMIMT
DQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIVKVSKNKQEMAFYSLPEFEEWKS
STPNHKKWKVKYYKGLGTSTSKEAKEYFADMKRHRIQFKYSGPEDDAAISLAFSKKQIDD
RKEWLTNFMEDRRQRKLLGLPEDYLYGQTTTYLTYNDFINKELILFSNSDNERSIPSMVD
GLKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSSYHHGEMSLMMTIINLAQNFVGSNN
LNLLQPIGQFGTRLHGGKDSASPRYIFTMLSSLARLLFPPKDDHTLKFLYDDNQRVEPEW
YIPIIPMVLINGAEGIGTGWSCKIPNFDVREIVNNIRRLMDGEEPLPMLPSYKNFKGTIE
ELAPNQYVISGEVAILNSTTIEISELPVRTWTQTYKEQVLEPMLNGTEKTPPLITDYREY
HTDTTVKFVVKMTEEKLAEAERVGLHKVFKLQTSLTCNSMVLFDHVGCLKKYDTVLDILR
DFFELRLKYYGLRKEWLLGMLGAESAKLNNQARFILEKIDGKIIIENKPKKELIKVLIQR
GYDSDPVKAWKEAQQKVPDEEENEESDNEKETEKSDSVTDSGPTFNYLLDMPLWYLTKEK
KDELCRLRNEKEQELDTLKRKSPSDLWKEDLATFIEELEAVEAKEKQDEQVGLPGKGGKA
KGKKTQMAEVLPSPRGQRVIPRITIEMKAEAEKKNKKKIKNENTEGSPQEDGVELEGLKQ
RLEKKQKREPGTKTKKQTTLAFKPIKKGKKRNPWSDSESDRSSDESNFDVPPRETEPRRA
ATKTKFTMDLDSDEDFSDFDEKTDDEDFVPSDASPPKTKTSPKLSNKELKPQKSVVSDLE
ADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKG
TKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKGESDDFHM
DFDSAVAPRAKSVRAKKPIKYLEESDEDDLF
NT seq 4596 nt   +upstreamnt  +downstreamnt
atggaagtgtcaccattgcagcctgtaaatgaaaatatgcaagtcaacaaaataaagaaa
aatgaagatgctaagaaaagactgtctgttgaaagaatctatcaaaagaaaacacaattg
gaacatattttgctccgcccagacacctacattggttctgtggaattagtgacccagcaa
atgtgggtttacgatgaagatgttggcattaactatagggaagtcacttttgttcctggt
ttgtacaaaatctttgatgagattctagttaatgctgcggacaacaaacaaagggaccca
aaaatgtcttgtattagagtcacaattgatccggaaaacaatttaattagtatatggaat
aatggaaaaggtattcctgttgttgaacacaaagttgaaaagatgtatgtcccagctctc
atatttggacagctcctaacttctagtaactatgatgatgatgaaaagaaagtgacaggt
ggtcgaaatggctatggagccaaattgtgtaacatattcagtaccaaatttactgtggaa
acagccagtagagaatacaagaaaatgttcaaacagacatggatggataatatgggaaga
gctggtgagatggaactcaagcccttcaatggagaagattatacatgtatcacctttcag
cctgatttgtctaagtttaaaatgcaaagcctggacaaagatattgttgcactaatggtc
agaagagcatatgatattgctggatccaccaaagatgtcaaagtctttcttaatggaaat
aaactgccagtaaaaggatttcgtagttatgtggacatgtatttgaaggacaagttggat
gaaactggtaactccttgaaagtaatacatgaacaagtaaaccacaggtgggaagtgtgt
ttaactatgagtgaaaaaggctttcagcaaattagctttgtcaacagcattgctacatcc
aagggtggcagacatgttgattatgtagctgatcagattgtgactaaacttgttgatgtt
gtgaagaagaagaacaagggtggtgttgcagtaaaagcacatcaggtgaaaaatcacatg
tggatttttgtaaatgccttaattgaaaacccaacctttgactctcagacaaaagaaaac
atgactttacaacccaagagctttggatcaacatgccaattgagtgaaaaatttatcaaa
gctgccattggctgtggtattgtagaaagcatactaaactgggtgaagtttaaggcccaa
gtccagttaaacaagaagtgttcagctgtaaaacataatagaatcaagggaattcccaaa
ctcgatgatgccaatgatgcagggggccgaaactccactgagtgtacgcttatcctgact
gagggagattcagccaaaactttggctgtttcaggccttggtgtggttgggagagacaaa
tatggggttttccctcttagaggaaaaatactcaatgttcgagaagcttctcataagcag
atcatggaaaatgctgagattaacaatatcatcaagattgtgggtcttcagtacaagaaa
aactatgaagatgaagattcattgaagacgcttcgttatgggaagataatgattatgaca
gatcaggaccaagatggttcccacatcaaaggcttgctgattaattttatccatcacaac
tggccctctcttctgcgacatcgttttctggaggaatttatcactcccattgtaaaggta
tctaaaaacaagcaagaaatggcattttacagccttcctgaatttgaagagtggaagagt
tctactccaaatcataaaaaatggaaagtcaaatattacaaaggtttgggcaccagcaca
tcaaaggaagctaaagaatactttgcagatatgaaaagacatcgtatccagttcaaatat
tctggtcctgaagatgatgctgctatcagcctggcctttagcaaaaaacagatagatgat
cgaaaggaatggttaactaatttcatggaggatagaagacaacgaaagttacttgggctt
cctgaggattacttgtatggacaaactaccacatatctgacatataatgacttcatcaac
aaggaacttatcttgttctcaaattctgataacgagagatctatcccttctatggtggat
ggtttgaaaccaggtcagagaaaggttttgtttacttgcttcaaacggaatgacaagcga
gaagtaaaggttgcccaattagctggatcagtggctgaaatgtcttcttatcatcatggt
gagatgtcactaatgatgaccattatcaatttggctcagaattttgtgggtagcaataat
ctaaacctcttgcagcccattggtcagtttggtaccaggctacatggtggcaaggattct
gctagtccacgatacatctttacaatgctcagctctttggctcgattgttatttccacca
aaagatgatcacacgttgaagtttttatatgatgacaaccagcgtgttgagcctgaatgg
tacattcctattattcccatggtgctgataaatggtgctgaaggaatcggtactgggtgg
tcctgcaaaatccccaactttgatgtgcgtgaaattgtaaataacatcaggcgtttgatg
gatggagaagaacctttgccaatgcttccaagttacaagaacttcaagggtactattgaa
gaactggctccaaatcaatatgtgattagtggtgaagtagctattcttaattctacaacc
attgaaatctcagagcttcccgtcagaacatggacccagacatacaaagaacaagttcta
gaacccatgttgaatggcaccgagaagacacctcctctcataacagactatagggaatac
catacagataccactgtgaaatttgttgtgaagatgactgaagaaaaactggcagaggca
gagagagttggactacacaaagtcttcaaactccaaactagtctcacatgcaactctatg
gtgctttttgaccacgtaggctgtttaaagaaatatgacacggtgttggatattctaaga
gacttttttgaactcagacttaaatattatggattaagaaaagaatggctcctaggaatg
cttggtgctgaatctgctaaactgaataatcaggctcgctttatcttagagaaaatagat
ggcaaaataatcattgaaaataagcctaagaaagaattaattaaagttctgattcagagg
ggatatgattcggatcctgtgaaggcctggaaagaagcccagcaaaaggttccagatgaa
gaagaaaatgaagagagtgacaacgaaaaggaaactgaaaagagtgactccgtaacagat
tctggaccaaccttcaactatcttcttgatatgcccctttggtatttaaccaaggaaaag
aaagatgaactctgcaggctaagaaatgaaaaagaacaagagctggacacattaaaaaga
aagagtccatcagatttgtggaaagaagacttggctacatttattgaagaattggaggct
gttgaagccaaggaaaaacaagatgaacaagtcggacttcctgggaaaggggggaaggcc
aaggggaaaaaaacacaaatggctgaagttttgccttctccgcgtggtcaaagagtcatt
ccacgaataaccatagaaatgaaagcagaggcagaaaagaaaaataaaaagaaaattaag
aatgaaaatactgaaggaagccctcaagaagatggtgtggaactagaaggcctaaaacaa
agattagaaaagaaacagaaaagagaaccaggtacaaagacaaagaaacaaactacattg
gcatttaagccaatcaaaaaaggaaagaagagaaatccctggtctgattcagaatcagat
aggagcagtgacgaaagtaattttgatgtccctccacgagaaacagagccacggagagca
gcaacaaaaacaaaattcacaatggatttggattcagatgaagatttctcagattttgat
gaaaaaactgatgatgaagattttgtcccatcagatgctagtccacctaagaccaaaact
tccccaaaacttagtaacaaagaactgaaaccacagaaaagtgtcgtgtcagaccttgaa
gctgatgatgttaagggcagtgtaccactgtcttcaagccctcctgctacacatttccca
gatgaaactgaaattacaaacccagttcctaaaaagaatgtgacagtgaagaagacagca
gcaaaaagtcagtcttccacctccactaccggtgccaaaaaaagggctgccccaaaagga
actaaaagggatccagctttgaattctggtgtctctcaaaagcctgatcctgccaaaacc
aagaatcgccgcaaaaggaagccatccacttctgatgattctgactctaattttgagaaa
attgtttcgaaagcagtcacaagcaagaaatccaagggggagagtgatgacttccatatg
gactttgactcagctgtggctcctcgggcaaaatctgtacgggcaaagaaacctataaag
tacctggaagagtcagatgaagatgatctgttttaa

KEGG   Homo sapiens (human): 7155
Entry
7155              CDS       T01001                                 

Gene name
TOP2B, TOPIIB, top2beta
Definition
(RefSeq) DNA topoisomerase II beta
  KO
K03164  DNA topoisomerase II [EC:5.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
Drug target
Aclarubicin (DG00699): D01911<JP> D02756
Aldoxorubicin (DG01726): D10383 D10384
Amonafide (DG01268): D10090 D10091
Amrubicin (DG00703): D07100<JP> D08854
Amsacrine: D02321
Becatecarin: D03220
Berubicin hydrochloride: D08871
Crisnatol mesylate: D03602
Daunorubicin (DG00697): D01264<JP/US> D07776 D10787
Dexrazoxane (DG01162): D03730<JP> D07807<US>
Doxorubicin (DG00696): D01275<JP/US> D03899
Elsamitrucin: D03977
Epirubicin (DG00698): D02214<JP/US> D07901
Etoposide (DG00693): D00125<JP/US> D04107<US>
Fostriecin sodium: D04262
Idarubicin (DG00700): D01747<JP/US> D08062
Idronoxil: D04498
Ledoxantrone trihydrochloride: D04685
Losoxantrone hydrochloride: D04783
Menogaril: D04914
Mitindomide: D05054
Mitoxantrone (DG00701): D02166<JP/US> D08224
Pirarubicin (DG00702): D01885 D08386<JP>
Piroxantrone hydrochloride: D05510
Pixantrone (DG00704): D05522 D09654
Quarfloxin: D08981
Sobuzoxane: D01404<JP>
Teloxantrone hydrochloride: D06059
Teniposide: D02698<US>
Tirapazamine: D06167
Topixantrone: D06190
Valrubicin: D02697<US>
Vosaroxin: D08024
Zorubicin: D06386
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    7155 (TOP2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    7155 (TOP2B)
   03036 Chromosome and associated proteins [BR:hsa03036]
    7155 (TOP2B)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     7155 (TOP2B)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Topoisomerases
   7155 (TOP2B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Chromosome condensation proteins
   Other regulators of chromosome condensation
    7155 (TOP2B)
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    7155 (TOP2B)
SSDB
Motif
Pfam: DNA_topoisoIV TOPRIM_C DNA_gyraseB DTHCT HATPase_c Toprim
Other DBs
NCBI-GeneID: 7155
NCBI-ProteinID: NP_001317629
OMIM: 126431
HGNC: 11990
Ensembl: ENSG00000077097
Vega: OTTHUMG00000155596
Pharos: Q02880(Tchem)
UniProt: Q02880
LinkDB
Structure
PDB: 

Position
3p24.2
AA seq 1626 aa
MAKSGGCGAGAGVGGGNGALTWVTLFDQNNAAKKEESETANKNDSSKKLSVERVYQKKTQ
LEHILLRPDTYIGSVEPLTQFMWVYDEDVGMNCREVTFVPGLYKIFDEILVNAADNKQRD
KNMTCIKVSIDPESNIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVT
GGRNGYGAKLCNIFSTKFTVETACKEYKHSFKQTWMNNMMKTSEAKIKHFDGEDYTCITF
QPDLSKFKMEKLDKDIVALMTRRAYDLAGSCRGVKVMFNGKKLPVNGFRSYVDLYVKDKL
DETGVALKVIHELANERWDVCLTLSEKGFQQISFVNSIATTKGGRHVDYVVDQVVGKLIE
VVKKKNKAGVSVKPFQVKNHIWVFINCLIENPTFDSQTKENMTLQPKSFGSKCQLSEKFF
KAASNCGIVESILNWVKFKAQTQLNKKCSSVKYSKIKGIPKLDDANDAGGKHSLECTLIL
TEGDSAKSLAVSGLGVIGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYK
KSYDDAESLKTLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVK
ASKNKQELSFYSIPEFDEWKKHIENQKAWKIKYYKGLGTSTAKEAKEYFADMERHRILFR
YAGPEDDAAITLAFSKKKIDDRKEWLTNFMEDRRQRRLHGLPEQFLYGTATKHLTYNDFI
NKELILFSNSDNERSIPSLVDGFKPGQRKVLFTCFKRNDKREVKVAQLAGSVAEMSAYHH
GEQALMMTIVNLAQNFVGSNNINLLQPIGQFGTRLHGGKDAASPRYIFTMLSTLARLLFP
AVDDNLLKFLYDDNQRVEPEWYIPIIPMVLINGAEGIGTGWACKLPNYDAREIVNNVRRM
LDGLDPHPMLPNYKNFKGTIQELGQNQYAVSGEIFVVDRNTVEITELPVRTWTQVYKEQV
LEPMLNGTDKTPALISDYKEYHTDTTVKFVVKMTEEKLAQAEAAGLHKVFKLQTTLTCNS
MVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKEWLVGMLGAESTKLNNQARFILEKI
QGKITIENRSKKDLIQMLVQRGYESDPVKAWKEAQEKAAEEDETQNQHDDSSSDSGTPSG
PDFNYILNMSLWSLTKEKVEELIKQRDAKGREVNDLKRKSPSDLWKEDLAAFVEELDKVE
SQEREDVLAGMSGKAIKGKVGKPKVKKLQLEETMPSPYGRRIIPEITAMKADASKKLLKK
KKGDLDTAAVKVEFDEEFSGAPVEGAGEEALTPSVPINKGPKPKREKKEPGTRVRKTPTS
SGKPSAKKVKKRNPWSDDESKSESDLEETEPVVIPRDSLLRRAAAERPKYTFDFSEEEDD
DADDDDDDNNDLEELKVKASPITNDGEDEFVPSDGLDKDEYTFSPGKSKATPEKSLHDKK
SQDFGNLFSFPSYSQKSEDDSAKFDSNEEDSASVFSPSFGLKQTDKVPSKTVAAKKGKPS
SDTVPKPKRAPKQKKVVEAVNSDSDSEFGIPKKTTTPKGKGRGAKKRKASGSENEGDYNP
GRKTSKTTSKKPKKTSFDQDSDVDIFPSDFPTEPPSLPRTGRARKEVKYFAESDEEEDDV
DFAMFN
NT seq 4881 nt   +upstreamnt  +downstreamnt
atggccaagtcgggtggctgcggcgcgggagccggcgtgggcggcggcaacggggcactg
acctgggtgactctttttgatcagaacaatgctgcaaaaaaagaagagtcagaaactgcc
aacaaaaatgattcttcaaagaagttgtctgttgagagagtgtatcagaagaagacacaa
cttgaacacattcttcttcgtcctgatacatatattgggtcagtggagccattgacgcag
ttcatgtgggtgtatgatgaagatgtaggaatgaattgcagggaggttacctttgtgcca
ggtttatacaagatctttgatgaaattttggttaatgctgctgacaataaacagagggat
aagaacatgacttgtattaaagtttctattgatcctgaatctaacattataagcatttgg
aataatgggaaaggcattccagtagtagaacacaaggtagagaaagtttatgttcctgct
ttaatttttggacagcttttaacatccagtaactatgatgatgatgagaaaaaagttaca
ggtggtcgtaatggttatggtgcaaaactttgtaatattttcagtacaaagtttacagta
gaaacagcttgcaaagaatacaaacacagttttaagcagacatggatgaataatatgatg
aagacttctgaagccaaaattaaacattttgatggtgaagattacacatgcataacattc
caaccagatctgtccaaatttaagatggaaaaacttgacaaggatattgtggccctcatg
actagaagggcatatgatttggctggttcgtgtagaggggtcaaggtcatgtttaatgga
aagaaattgcctgtaaatggatttcgcagttatgtagatctttatgtgaaagacaaattg
gatgaaactggggtggccctgaaagttattcatgagcttgcaaatgaaagatgggatgtt
tgtctcacattgagtgaaaaaggattccagcaaatcagctttgtaaatagtattgcaact
acaaaaggtggacggcacgtggattatgtggtagatcaagttgttggtaaactgattgaa
gtagttaagaaaaagaacaaagctggtgtatcagtgaaaccatttcaagtaaaaaaccat
atatgggtttttattaattgccttattgaaaatccaacttttgattctcagactaaggaa
aacatgactctgcagcccaaaagttttgggtctaaatgccagctgtcagaaaaatttttt
aaagcagcctctaattgtggcattgtagaaagtatcctgaactgggtgaaatttaaggct
cagactcagctgaataagaagtgttcatcagtaaaatacagtaaaatcaaaggtattccc
aaactggatgatgctaatgatgctggtggtaaacattccctggagtgtacactgatatta
acagagggagactctgccaaatcactggctgtgtctggattaggtgtgattggacgagac
agatacggagtttttccactcaggggcaaaattcttaatgtacgggaagcttctcataaa
cagatcatggaaaatgctgaaataaataatattattaaaatagttggtctacaatataag
aaaagttacgatgatgcagaatctctgaaaaccttacgctatggaaagattatgattatg
accgatcaggatcaagatggttctcacataaaaggcctgcttattaatttcatccatcac
aattggccatcacttttgaagcatggttttcttgaagagttcattactcctattgtaaag
gcaagcaaaaataagcaggaactttccttctacagtattcctgaatttgacgaatggaaa
aaacatatagaaaaccagaaagcctggaaaataaagtactataaaggattgggtactagt
acagctaaagaagcaaaggaatattttgctgatatggaaaggcatcgcatcttgtttaga
tatgctggtcctgaagatgatgctgccattaccttggcatttagtaagaagaagattgat
gacagaaaagaatggttaacaaattttatggaagaccggagacagcgtaggctacatggc
ttaccagagcaatttttatatggtactgcaacaaagcatttgacttataatgatttcatc
aacaaggaattgattctcttctcaaactcagacaatgaaagatctataccatctcttgtt
gatggctttaaacctggccagcggaaagttttatttacctgtttcaagaggaatgataaa
cgtgaagtaaaagttgcccagttggctggctctgttgctgagatgtcggcttatcatcat
ggagaacaagcattgatgatgactattgtgaatttggctcagaactttgtgggaagtaac
aacattaacttgcttcagcctattggtcagtttggaactcggcttcatggtggcaaagat
gctgcaagccctcgttatattttcacaatgttaagcactttagcaaggctactttttcct
gctgtggatgacaacctccttaagttcctttatgatgataatcaacgtgtagagcctgag
tggtatattcctataattcccatggttttaataaatggtgctgagggcattggtactgga
tgggcttgtaaactacccaactatgatgctagggaaattgtgaacaatgtcagacgaatg
ctagatggcctggatcctcatcccatgcttccaaactacaaaaactttaaaggcacgatt
caagaacttggtcaaaaccagtatgcagtcagtggtgaaatatttgtagtggacagaaac
acagtagaaattacagagcttccagttagaacttggacacaggtatataaagaacaggtt
ttagaacctatgctaaatggaacagataaaacaccagcattaatttctgattataaagaa
tatcatactgacacaactgtgaaatttgtggtgaaaatgactgaagagaaactagcacaa
gcagaagctgctggactgcataaagtttttaaacttcaaactactcttacttgtaattcc
atggtactttttgatcatatgggatgtctgaagaaatatgaaactgtgcaagacattctg
aaagaattctttgatttacgattaagttattacggtttacgtaaggagtggcttgtggga
atgttgggagcagaatctacaaagcttaacaatcaagcccgtttcattttagagaagata
caagggaaaattactatagagaataggtcaaagaaagatttgattcaaatgttagtccag
agaggttatgaatctgacccagtgaaagcctggaaagaagcacaagaaaaggcagcagaa
gaggatgaaacacaaaaccagcatgatgatagttcctccgattcaggaactccttcaggc
ccagattttaattatattttaaatatgtctctgtggtctcttactaaagaaaaagttgaa
gaactgattaaacagagagatgcaaaagggcgagaggtcaatgatcttaaaagaaaatct
ccttcagatctttggaaagaggatttagcggcatttgttgaagaactggataaagtggaa
tctcaagaacgagaagatgttctggctggaatgtctggaaaagcaattaaaggtaaagtt
ggcaaacctaaggtgaagaaactccagttggaagagacaatgccctcaccttatggcaga
agaataattcctgaaattacagctatgaaggcagatgccagcaaaaagttgctgaagaag
aagaagggtgatcttgatactgcagcagtaaaagtggaatttgatgaagaattcagtgga
gcaccagtagaaggtgcaggagaagaggcattgactccatcagttcctataaataaaggt
cccaaacctaagagggagaagaaggagcctggtaccagagtgagaaaaacacctacatca
tctggtaaacctagtgcaaagaaagtgaagaaacggaatccttggtcagatgatgaatcc
aagtcagaaagtgatttggaagaaacagaacctgtggttattccaagagattctttgctt
aggagagcagcagccgaaagacctaaatacacatttgatttctcagaagaagaggatgat
gatgctgatgatgatgatgatgacaataatgatttagaggaattgaaagttaaagcatct
cccataacaaatgatggggaagatgaatttgttccttcagatgggttagataaagatgaa
tatacattttcaccaggcaaatcaaaagccactccagaaaaatctttgcatgacaaaaaa
agtcaggattttggaaatctcttctcatttccttcatattctcagaagtcagaagatgat
tcagctaaatttgacagtaatgaagaagattctgcttctgttttttcaccatcatttggt
ctgaaacagacagataaagttccaagtaaaacggtagctgctaaaaagggaaaaccgtct
tcagatacagtccctaagcccaagagagccccaaaacagaagaaagtagtagaggctgta
aactctgactcggattcagaatttggcattccaaagaagactacaacaccaaaaggtaaa
ggccgaggggcaaagaaaaggaaagcatctggctctgaaaatgaaggcgattataaccct
ggcaggaaaacatccaaaacaacaagcaagaaaccgaagaagacatcttttgatcaggat
tcagatgtggacatcttcccctcagacttccctactgagccaccttctctgccacgaacc
ggtcgggctaggaaagaagtaaaatattttgcagagtctgatgaagaagaagatgatgtt
gattttgcaatgtttaattaa

DBGET integrated database retrieval system