KEGG   Homo sapiens (human): 10454
Entry
10454             CDS       T01001                                 

Gene name
TAB1, 3'-Tab1, MAP3K7IP1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 1
  KO
K04403  TAK1-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05417  Lipid and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    10454 (TAB1)
   04064 NF-kappa B signaling pathway
    10454 (TAB1)
   04668 TNF signaling pathway
    10454 (TAB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    10454 (TAB1)
   04621 NOD-like receptor signaling pathway
    10454 (TAB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    10454 (TAB1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    10454 (TAB1)
   05161 Hepatitis B
    10454 (TAB1)
   05168 Herpes simplex virus 1 infection
    10454 (TAB1)
   05169 Epstein-Barr virus infection
    10454 (TAB1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    10454 (TAB1)
   05132 Salmonella infection
    10454 (TAB1)
   05131 Shigellosis
    10454 (TAB1)
   05135 Yersinia infection
    10454 (TAB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    10454 (TAB1)
   05140 Leishmaniasis
    10454 (TAB1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    10454 (TAB1)
SSDB
Motif
Pfam: PP2C
Other DBs
NCBI-GeneID: 10454
NCBI-ProteinID: NP_006107
OMIM: 602615
HGNC: 18157
Ensembl: ENSG00000100324
Vega: OTTHUMG00000151102
Pharos: Q15750(Tbio)
UniProt: Q15750 A8K6K3
LinkDB
Structure
PDB: 

Position
22q13.1
AA seq 504 aa
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcggcgcagaggaggagcttgctgcagagtgagcagcagccaagctggacagatgac
ctgcctctctgccacctctctggggttggctcagcctccaaccgcagctactctgctgat
ggcaagggcactgagagccacccgccagaggacagctggctcaagttcaggagtgagaac
aactgcttcctgtatggggtcttcaacggctatgatggcaaccgagtgaccaacttcgtg
gcccagcggctgtccgcagagctcctgctgggccagctgaatgccgagcacgccgaggcc
gatgtgcggcgtgtgctgctgcaggccttcgatgtggtggagaggagcttcctggagtcc
attgacgacgccttggctgagaaggcaagcctccagtcgcaattgccagagggagtccct
cagcaccagctgcctcctcagtatcagaagatccttgagagactcaagacgttagagagg
gaaatttcgggaggggccatggccgttgtggcggtccttctcaacaacaagctctacgtc
gccaatgtcggtacaaaccgtgcacttttatgcaaatcgacagtggatgggttgcaggtg
acacagctgaacgtggaccacaccacagagaacgaggatgagctcttccgtctttcgcag
ctgggcttggatgctggaaagatcaagcaggtggggatcatctgtgggcaggagagcacc
cggcggatcggggattacaaggttaaatatggctacacggacattgaccttctcagcgct
gccaagtccaaaccaatcatcgcagagccagaaatccatggggcacagccgctggatggg
gtgacgggcttcttggtgctgatgtcggaggggttgtacaaggccctagaggcagcccat
gggcctgggcaggccaaccaggagattgctgcgatgattgacactgagtttgccaagcag
acctccctggacgcagtggcccaggccgtcgtggaccgggtgaagcgcatccacagcgac
accttcgccagtggtggggagcgtgccaggttctgcccccggcacgaggacatgaccctg
ctagtgaggaactttggctacccgctgggcgaaatgagccagcccacaccgagcccagcc
ccagctgcaggaggacgagtgtaccctgtgtctgtgccatactccagcgcccagagcacc
agcaagaccagcgtgaccctctcccttgtcatgccctcccagggccagatggtcaacggg
gctcacagtgcttccaccctggacgaagccacccccaccctcaccaaccaaagcccgacc
ttaaccctgcagtccaccaacacgcacacgcagagcagcagctccagctctgacggaggc
ctcttccgctcccggcccgcccactcgctcccgcctggcgaggacggtcgtgttgagccc
tatgtggactttgctgagttttaccgcctctggagcgtggaccatggcgagcagagcgtg
gtgacagcaccgtag

KEGG   Homo sapiens (human): 23118
Entry
23118             CDS       T01001                                 

Gene name
TAB2, CHTD2, MAP3K7IP2, TAB-2
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 2
  KO
K04404  TAK1-binding protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
Disease
H02199  Congenital heart defects, multiple type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    23118 (TAB2)
   04064 NF-kappa B signaling pathway
    23118 (TAB2)
   04668 TNF signaling pathway
    23118 (TAB2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23118 (TAB2)
   04621 NOD-like receptor signaling pathway
    23118 (TAB2)
   04657 IL-17 signaling pathway
    23118 (TAB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    23118 (TAB2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    23118 (TAB2)
   05161 Hepatitis B
    23118 (TAB2)
   05171 Coronavirus disease - COVID-19
    23118 (TAB2)
   05162 Measles
    23118 (TAB2)
   05168 Herpes simplex virus 1 infection
    23118 (TAB2)
   05169 Epstein-Barr virus infection
    23118 (TAB2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23118 (TAB2)
   05132 Salmonella infection
    23118 (TAB2)
   05131 Shigellosis
    23118 (TAB2)
   05135 Yersinia infection
    23118 (TAB2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23118 (TAB2)
   05140 Leishmaniasis
    23118 (TAB2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    23118 (TAB2)
SSDB
Motif
Pfam: CUE zf-RanBP DivIC
Other DBs
NCBI-GeneID: 23118
NCBI-ProteinID: NP_001278963
OMIM: 605101
HGNC: 17075
Ensembl: ENSG00000055208 ENSG00000228408
Vega: OTTHUMG00000015783
Pharos: Q9NYJ8(Tbio)
UniProt: Q9NYJ8
LinkDB
Structure
PDB: 
2WWZ 2WX0 2WX1 2DAE

Position
6q25.1
AA seq 693 aa
MAQGSHQIDFQVLHDLRQKFPEVPEVVVSRCMLQNNNNLDACCAVLSQESTRYLYGEGDL
NFSDDSGISGLRNHMTSLNLDLQSQNIYHHGREGSRMNGSRTLTHSISDGQLQGGQSNSE
LFQQEPQTAPAQVPQGFNVFGMSSSSGASNSAPHLGFHLGSKGTSSLSQQTPRFNPIMVT
LAPNIQTGRNTPTSLHIHGVPPPVLNSPQGNSIYIRPYITTPGGTTRQTQQHSGWVSQFN
PMNPQQVYQPSQPGPWTTCPASNPLSHTSSQQPNQQGHQTSHVYMPISSPTTSQPPTIHS
SGSSQSSAHSQYNIQNISTGPRKNQIEIKLEPPQRNNSSKLRSSGPRTSSTSSSVNSQTL
NRNQPTVYIAASPPNTDELMSRSQPKVYISANAATGDEQVMRNQPTLFISTNSGASAASR
NMSGQVSMGPAFIHHHPPKSRAIGNNSATSPRVVVTQPNTKYTFKITVSPNKPPAVSPGV
VSPTFELTNLLNHPDHYVETENIQHLTDPTLAHVDRISETRKLSMGSDDAAYTQALLVHQ
KARMERLQRELEIQKKKLDKLKSEVNEMENNLTRRRLKRSNSISQIPSLEEMQQLRSCNR
QLQIDIDCLTKEIDLFQARGPHFNPSAIHNFYDNIGFVGPVPPKPKDQRSIIKTPKTQDT
EDDEGAQWNCTACTFLNHPALIRCEQCEMPRHF
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcccaaggaagccaccaaattgattttcaggttttacatgacctgcgacaaaaattc
cctgaagtacctgaagttgttgtatccaggtgcatgttacagaataataataacctggat
gcctgctgtgctgttctctctcaggagagtacaagatatctttatggtgaaggagacttg
aatttttcagatgattctggaatttctggtctacgcaatcacatgacttctctcaacttg
gacttgcaatcacagaacatttaccaccatggaagagaaggaagtaggatgaatggaagt
aggactctaacgcacagcattagtgatggacaacttcaaggtggccagtccaatagtgaa
ctatttcagcaggagccacagacagcaccagctcaagttcctcaaggctttaatgttttt
ggaatgtccagttcctctggtgcttcaaattcagcaccacatcttggatttcacttaggc
agcaaaggaacatctagcctttctcaacaaactcccagatttaatcccattatggtaact
ttagccccaaatatccagactggtcgtaatactcctacatctttgcacatacatggtgta
cctccacctgtacttaacagtccacagggaaattctatctatattaggccttacattaca
actcctggtggtacaactcgacagacacaacagcattctggctgggtatctcagtttaat
cccatgaaccctcagcaagtttatcagccttcacagcctggtccctggactacttgtcct
gcatctaatcctctgtcacatacctcatctcaacagccaaatcagcaaggccaccagacc
tctcatgtctacatgccaatcagttcacctactacttcacaaccaccaaccattcattca
tctggtagctcacagtcttctgcccatagccaatataacattcagaatatttcaacagga
cctcgaaaaaaccagattgaaatcaaacttgaacccccacaaagaaataattcttcaaaa
ctgcgttcttctggacctcgaacctccagcacttcctcttcagtcaatagccagacctta
aacagaaatcagcccactgtttacatagctgccagccccccaaatacggatgagctgatg
tcccgtagtcaacctaaggtctatatttcagcgaatgctgccacaggagatgaacaggtc
atgcggaatcagcccacactcttcatatccacaaactctggagcatctgctgcctccagg
aacatgtctgggcaagtgagcatgggtcctgcctttattcatcaccatcctcccaaaagt
cgagcaataggcaataactctgcaacctctcctcgagtggtagtcactcagcccaatacg
aaatacactttcaaaattacagtctctcccaataagccccctgcagtttcaccaggggtg
gtgtcccctacctttgaacttacaaatcttcttaatcatcctgatcattatgtagaaacc
gagaatattcagcacctcacggaccctacattagcacatgtggatagaataagtgaaaca
cggaaactgagtatgggatctgatgatgctgcctacacacaagctcttttggtacaccag
aaggccagaatggaacgacttcaaagagaacttgagattcaaaagaaaaagctggataaa
ttaaaatctgaggttaatgaaatggaaaataatctaactcgaaggcgcctgaaaagatca
aattctatatcccagataccttcccttgaagaaatgcagcagctgagaagttgtaataga
caactccagattgacattgactgcttaaccaaagaaattgatctttttcaagcccgagga
ccacattttaaccccagcgctattcataacttttatgacaatattggatttgtaggtcct
gtgccaccaaaacccaaagatcaaaggtccatcatcaaaacaccaaagactcaagacaca
gaagatgatgagggagctcagtggaattgtaccgcctgtacttttttgaaccatccagcc
ttaattcgctgtgaacagtgtgagatgccaaggcatttctga

KEGG   Homo sapiens (human): 257397
Entry
257397            CDS       T01001                                 

Gene name
TAB3, MAP3K7IP3, NAP1
Definition
(RefSeq) TGF-beta activated kinase 1 (MAP3K7) binding protein 3
  KO
K12793  TAK1-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
  Element
N00151  TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00927  Escherichia/Shigella NleE/OspZ to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    257397 (TAB3)
   04668 TNF signaling pathway
    257397 (TAB3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    257397 (TAB3)
   04657 IL-17 signaling pathway
    257397 (TAB3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    257397 (TAB3)
   05132 Salmonella infection
    257397 (TAB3)
   05131 Shigellosis
    257397 (TAB3)
SSDB
Motif
Pfam: CUE zf-RanBP Tmemb_cc2
Other DBs
NCBI-GeneID: 257397
NCBI-ProteinID: NP_690000
OMIM: 300480
HGNC: 30681
Ensembl: ENSG00000157625
Vega: OTTHUMG00000021329
Pharos: Q8N5C8(Tbio)
UniProt: Q8N5C8
LinkDB
Position
Xp21.2
AA seq 712 aa
MAQSSPQLDIQVLHDLRQRFPEIPEGVVSQCMLQNNNNLEACCRALSQESSKYLYMEYHS
PDDNRMNRNRLLHINLGIHSPSSYHPGDGAQLNGGRTLVHSSSDGHIDPQHAAGKQLICL
VQEPHSAPAVVAATPNYNPFFMNEQNRSAATPPSQPPQQPSSMQTGMNPSAMQGPSPPPP
PPSYMHIPRYSTNPITVTVSQNLPSGQTVPRALQILPQIPSNLYGSPGSIYIRQTSQSSS
GRQTPQSTPWQSSPQGPVPHYSQRPLPVYPHQQNYQPSQYSPKQQQIPQSAYHSPPPSQC
PSPFSSPQHQVQPSQLGHIFMPPSPSTTPPHPYQQGPPSYQKQGSHSVAYLPYTASSLSK
GSMKKIEITVEPSQRPGTAINRSPSPISNQPSPRNQHSLYTATTPPSSSPSRGISSQPKP
PFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAP
EPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYAYTQALLLHQRARMERLAKQLKLEKEEL
ERLKSEVNGMEHDLMQRRLRRVSCTTAIPTPEEMTRLRSMNRQLQINVDCTLKEVDLLQS
RGNFDPKAMNNFYDNIEPGPVVPPKPSKKDSSDPCTIERKARRISVTSKVQADIHDTQAA
AADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggcgcaaagcagcccacagcttgatattcaggttctccatgatcttcgacaacgtttc
cctgaaattccagagggcgtggtgtctcagtgcatgttacagaataacaacaatcttgaa
gcctgttgccgagccctttcccaggagagtagcaaatacttatatatggaataccatagt
ccagatgacaataggatgaatagaaatcgccttttacatattaacctgggtatccattct
cctagtagctatcacccaggagatggagcccaacttaatggtggtcgaacactggtacat
agctcaagtgatggacatattgatcctcagcatgcagcaggtaaacagctgatatgttta
gttcaagaaccacactcagctccagctgttgttgctgctactcccaactacaatccattt
tttatgaacgaacagaacagaagtgcagctactcctccttcacaaccacctcaacagcca
tcttccatgcaaacaggaatgaatccgtctgctatgcaagggccttcaccaccaccgcca
cctccttcatacatgcacatacctcggtatagtacaaatccaattactgttacagtatcc
cagaacctcccttctggacagactgtaccaagagctttacaaattcttccacaaattcca
agcaatctctatgggtctcctggttctatttatattagacagacatctcagagttcatca
ggaagacaaactcctcagagtacgccgtggcagtcctcaccacagggcccagtgcctcac
tatagccagcgtcctttacctgtttatccacaccaacagaactatcagccttctcagtat
tctcccaaacagcagcagatccctcagtctgcttaccattcaccacctccttctcaatgt
ccttcacccttcagctctccacagcatcaagtgcaaccttcccagttgggccacatcttt
atgccacctagtccttcaactactccaccccatccatatcaacaaggacctcctagctat
cagaaacagggaagccattcagtagcctatcttccatacacagcatctagtttatccaaa
ggttccatgaagaagatagaaattacagttgaaccttctcaaagacctgggacagcaatt
aataggagtccttcacccatcagtaatcaaccatctccacggaatcaacactcactgtac
acagccaccacgccaccttcaagttctccttcaagagggatatctagtcaaccaaaacct
ccatttagtgttaatcctgtgtatattacatatacacagccaactggaccttcttgtact
ccatcaccatctcctcgagtgataccaaacccaactacagtttttaaaattaccgtaggc
cgagcaacgactgaaaatcttttaaatttagtggaccaagaagagcgctctgcagcacca
gaacctattcagcccatttcagtgataccaggctctgggggagaaaagggaagccataaa
tatcagagaagttctagttctggatcagatgactatgcctacacacaagccttgctgtta
catcaacgagcaaggatggagaggttagcaaagcaactgaaacttgagaaagaggagcta
gagcggttgaagtctgaagttaatggtatggagcatgacctgatgcagagacggctcaga
agagtcagctgcaccactgcgatccctacgcctgaggaaatgacaagattgagaagcatg
aacagacaactccagataaatgttgactgtacactgaaagaagttgacctccttcaatct
agaggaaactttgatccaaaagccatgaataatttttatgacaacatagaacctggccca
gttgtaccacccaagccatctaaaaaagactcctcagacccctgcacaattgagagaaaa
gcccgaagaattagcgtgacctccaaagtacaggcagacatccatgacacccaggcagca
gctgcagatgagcatcgaactggctccacacaaagtcctcggacacaacctcgagatgaa
gactacgaaggggctccatggaattgtgatagctgcacctttcttaaccacccagcacta
aatcgctgtgagcagtgcgagatgccacggtacacctga

KEGG   Homo sapiens (human): 6885
Entry
6885              CDS       T01001                                 

Gene name
MAP3K7, CSCF, FMD2, MEKK7, TAK1, TGF1a
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 7
  KO
K04427  mitogen-activated protein kinase kinase kinase 7 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04140  Autophagy - animal
hsa04152  AMPK signaling pathway
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04520  Adherens junction
hsa04613  Neutrophil extracellular trap formation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05145  Toxoplasmosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05417  Lipid and atherosclerosis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses and bacteria)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06223  TNF signaling
nt06263  Hepatocellular carcinoma
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00151  TNF-NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00186  IL1-IL1R-p38 signaling pathway
N00188  IL1-IL1R-JNK signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00438  TLR2/4-MAPK signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00444  TNF-p38 signaling pathway
N00446  TNF-JNK signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00562  HSV US3 to TLR2/4-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Disease
H02226  Cardiospondylocarpofacial syndrome
H02227  Frontometaphyseal dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    6885 (MAP3K7)
   04310 Wnt signaling pathway
    6885 (MAP3K7)
   04064 NF-kappa B signaling pathway
    6885 (MAP3K7)
   04668 TNF signaling pathway
    6885 (MAP3K7)
   04152 AMPK signaling pathway
    6885 (MAP3K7)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    6885 (MAP3K7)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    6885 (MAP3K7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    6885 (MAP3K7)
   04620 Toll-like receptor signaling pathway
    6885 (MAP3K7)
   04621 NOD-like receptor signaling pathway
    6885 (MAP3K7)
   04622 RIG-I-like receptor signaling pathway
    6885 (MAP3K7)
   04660 T cell receptor signaling pathway
    6885 (MAP3K7)
   04657 IL-17 signaling pathway
    6885 (MAP3K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    6885 (MAP3K7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    6885 (MAP3K7)
   05161 Hepatitis B
    6885 (MAP3K7)
   05171 Coronavirus disease - COVID-19
    6885 (MAP3K7)
   05162 Measles
    6885 (MAP3K7)
   05168 Herpes simplex virus 1 infection
    6885 (MAP3K7)
   05169 Epstein-Barr virus infection
    6885 (MAP3K7)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    6885 (MAP3K7)
   05132 Salmonella infection
    6885 (MAP3K7)
   05131 Shigellosis
    6885 (MAP3K7)
   05135 Yersinia infection
    6885 (MAP3K7)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    6885 (MAP3K7)
   05140 Leishmaniasis
    6885 (MAP3K7)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    6885 (MAP3K7)
   05418 Fluid shear stress and atherosclerosis
    6885 (MAP3K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6885 (MAP3K7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     6885 (MAP3K7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   6885 (MAP3K7)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase APH
Other DBs
NCBI-GeneID: 6885
NCBI-ProteinID: NP_663304
OMIM: 602614
HGNC: 6859
Ensembl: ENSG00000135341
Vega: OTTHUMG00000015217
Pharos: O43318(Tchem)
UniProt: O43318
LinkDB
Structure
PDB: 

Position
6q15
AA seq 606 aa
MSTASAASSSSSSSAGEMIEAPSQVLNFEEIDYKEIEVEEVVGRGAFGVVCKAKWRAKDV
AIKQIESESERKAFIVELRQLSRVNHPNIVKLYGACLNPVCLVMEYAEGGSLYNVLHGAE
PLPYYTAAHAMSWCLQCSQGVAYLHSMQPKALIHRDLKPPNLLLVAGGTVLKICDFGTAC
DIQTHMTNNKGSAAWMAPEVFEGSNYSEKCDVFSWGIILWEVITRRKPFDEIGGPAFRIM
WAVHNGTRPPLIKNLPKPIESLMTRCWSKDPSQRPSMEEIVKIMTHLMRYFPGADEPLQY
PCQYSDEGQSNSATSTGSFMDIASTNTSNKSDTNMEQVPATNDTIKRLESKLLKNQAKQQ
SESGRLSLGASRGSSVESLPPTSEGKRMSADMSEIEARIAATTAYSKPKRGHRKTASFGN
ILDVPEIVISGNGQPRRRSIQDLTVTGTEPGQVSSRSSSPSVRMITTSGPTSEKPTRSHP
WTPDDSTDTNGSDNSIPMAYLTLDHQLQPLAPCPNSKESMAVFEQHCKMAQEYMKVQTEI
ALLLQRKQELVAELDQDEKDQQNTSRLVQEHKKLLDENKSLSTYYQQCKKQLEVIRSQQQ
KRQGTS
NT seq 1821 nt   +upstreamnt  +downstreamnt
atgtctacagcctctgccgcctcctcctcctcctcgtcttcggccggtgagatgatcgaa
gccccttcccaggtcctcaactttgaagagatcgactacaaggagatcgaggtggaagag
gttgttggaagaggagcctttggagttgtttgcaaagctaagtggagagcaaaagatgtt
gctattaaacaaatagaaagtgaatctgagaggaaagcgtttattgtagagcttcggcag
ttatcccgtgtgaaccatcctaatattgtaaagctttatggagcctgcttgaatccagtg
tgtcttgtgatggaatatgctgaagggggctctttatataatgtgctgcatggtgctgaa
ccattgccatattatactgctgcccacgcaatgagttggtgtttacagtgttcccaagga
gtggcttatcttcacagcatgcaacccaaagcgctaattcacagggacctgaaaccacca
aacttactgctggttgcaggggggacagttctaaaaatttgtgattttggtacagcctgt
gacattcagacacacatgaccaataacaaggggagtgctgcttggatggcacctgaagtt
tttgaaggtagtaattacagtgaaaaatgtgacgtcttcagctggggtattattctttgg
gaagtgataacgcgtcggaaaccctttgatgagattggtggcccagctttccgaatcatg
tgggctgttcataatggtactcgaccaccactgataaaaaatttacctaagcccattgag
agcctgatgactcgttgttggtctaaagatccttcccagcgcccttcaatggaggaaatt
gtgaaaataatgactcacttgatgcggtactttccaggagcagatgagccattacagtat
ccttgtcagtattcagatgaaggacagagcaactctgccaccagtacaggctcattcatg
gacattgcttctacaaatacgagtaacaaaagtgacactaatatggagcaagttcctgcc
acaaatgatactattaagcgcttagaatcaaaattgttgaaaaatcaggcaaagcaacag
agtgaatctggacgtttaagcttgggagcctcccgtgggagcagtgtggagagcttgccc
ccaacctctgagggcaagaggatgagtgctgacatgtctgaaatagaagctaggatcgcc
gcaaccacagcctattccaagcctaaacggggccaccgtaaaactgcttcatttggcaac
attctggatgtccctgagatcgtcatatcaggcaacggacagccaagacgtagatccatc
caagacttgactgtaactggaacagaacctggtcaggtgagcagtaggtcatccagtccc
agtgtcagaatgattactacctcaggaccaacctcagaaaagccaactcgaagtcatcca
tggacccctgatgattccacagataccaatggatcagataactccatcccaatggcttat
cttacactggatcaccaactacagcctctagcaccgtgcccaaactccaaagaatctatg
gcagtgtttgaacagcattgtaaaatggcacaagaatatatgaaagttcaaacagaaatt
gcattgttattacagagaaagcaagaactagttgcagaactggaccaggatgaaaaggac
cagcaaaatacatctcgcctggtacaggaacataaaaagcttttagatgaaaacaaaagc
ctttctacttactaccagcaatgcaaaaaacaactagaggtcatcagaagtcagcagcag
aaacgacaaggcacttcatga

DBGET integrated database retrieval system